KEGG   Pyrenophora teres: PTT_10235Help
Entry
PTT_10235         CDS       T01613                                 

Definition
(GenBank) hypothetical protein
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
pte  Pyrenophora teres
Brite
Enzymes [BR:pte01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     PTT_10235
Peptidases [BR:pte01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   PTT_10235
Exosome [BR:pte04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PTT_10235
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2
Motif
Other DBs
NCBI-ProteinID: EFQ92628
UniProt: E3RNS2
LinkDB All DBs
Position
Unknown
AA seq 263 aa AA seqDB search
MRFQTIVAFALPALALAVPTPQDPNVEFPADTPDEDIVGGTTAASGEFPYIVSLQVSGSH
ICGGSLINGNTVVTAAHCSVSSVIGSVSRLTIRAGSLSRTSGGTVVAVSSVNINPNYRST
GQDYDIAVWKLSSSIPTSNTIKYVSLPASGSDPAAGSTVTVAGWGTLSSGGSSPNALYKV
SVPVVSRTSCRSSYGSTITNNMVCAGLTAGGKDSCQGDSGGPLVDASKTLVGVVSFGNGC
AAPGYPGVYSRVSTFLPFIAQYA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttccaaaccatcgtcgctttcgcgctcccagcgctcgctcttgctgttcctact
ccccaggaccccaacgtcgagttccctgccgacactccggatgaggacattgttggtgga
accaccgctgcctctggcgagttcccctacattgtctctctccaggtcagcggatcccac
atctgcggtggttcgctcatcaacggcaacactgttgtcactgctgctcactgctccgtg
agctccgtcattggctccgtcagcagactcaccatccgcgccggttccttgagccgcacc
tctggtggcactgtcgtcgctgtctcctccgtcaacattaaccccaactaccgcagcacc
ggccaggactacgatattgccgtctggaagctgtcttcctccatccccaccagcaacacc
atcaaatacgtcagcctcccagcctctggctctgaccctgctgccggttccaccgtcacc
gttgccggctggggcactctcagctccggtggcagcagccccaacgccctctacaaggtc
agcgttcccgtcgtgtcccgcaccagctgccgctccagctacggctctaccatcaccaac
aacatggtctgcgctggtcttaccgccggtggcaaggactcttgccaaggggactctggc
ggccctcttgtcgatgcctccaagacccttgtcggtgtcgtttctttcggcaacggctgc
gctgctcctggataccctggtgtctactcccgtgtcagcaccttcctccccttcatcgca
cagtacgcctaa

DBGET integrated database retrieval system