KEGG   Pyrenophora teres: PTT_13780Help
Entry
PTT_13780         CDS       T01613                                 

Definition
(GenBank) hypothetical protein
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
pte  Pyrenophora teres
Pathway
pte00730  Thiamine metabolism
pte00790  Folate biosynthesis
pte01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pte00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    PTT_13780
   00790 Folate biosynthesis
    PTT_13780
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pte04147]
    PTT_13780
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pte00537]
    PTT_13780
Enzymes [BR:pte01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     PTT_13780
Exosome [BR:pte04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PTT_13780
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pte00537]
 Enzymes
  PTT_13780
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-ProteinID: EFQ89811
UniProt: E3RWT2
LinkDB All DBs
Position
Unknown
AA seq 598 aa AA seqDB search
MSGARPLLSNRASSDISGDRDMAEEDALLTGRRTGHTEKDGSRPWKFWREIGLFVWAVMA
TSAVVFLAVIFQQSNADSQTPKASGKRNLIFMVSDGMGPTSLSLTRSYMQFKNGAPFSEQ
LVIDQHLIGQSRTRSSSSLITDSAAGATAFSCAQKSYNGAISVTPDHEPCGTVLEAAKKA
GYMTGLVVTTRITDATPACFAAHVNMRSEEDRIAEQMVGEHPLGRVVDLMFGGGRCHFLP
NSTIDSSCRADGKDVIGLAKKNGFSYISDRAGFDKLKQGANVDMPMLGLFADTDIPYEID
RRNENHVYPSLHEMAEAAMRALSDATRDSDKGFFLMIEGSRIDHAGHHNDPAAQVHEVLA
YDRAFNSVLDFIKRETTQTVMVSTSDHETGGLAVARQLHTSYPEYAWYPSPLANASHSAE
RLALLYAKHLLSGPTPDQKADFVRDSISNGLGINDYTDEEVQNLVKTPDTALYQYADMMS
RRSQTGWSTHGHSGADVNIYSSDPKAATALVGNHENTEVGDFLRDYLAVDVEAVTKELRQ
KGKGFMVQIINDTEISWIGKVPVDGERLDGQTHLASYSGDHKKRNLGSVHGDDCGCGH
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgtccggcgctcgaccactcctttccaaccgcgcctcctcggacataagcggagatcgc
gacatggcagaggaagacgccctccttaccggccgtcgcactggacacacagagaaggac
ggatcgcggccttggaagttctggcgcgagataggccttttcgtgtgggctgtcatggca
acatccgccgtcgtcttcctcgccgtcatcttccagcaatccaacgccgactcccaaacg
cccaaggcgagcgggaagaggaacctgattttcatggtctccgatggcatgggtcccacg
tcactatcgctcacacggtcttatatgcaattcaagaacggtgcgccgttcagtgagcag
ctggtcatcgaccaacatctcatcggccagtcgcgcacacgaagctcttcctcgctcatc
accgattccgcagcgggtgcgactgctttttcgtgcgcacagaagagctacaatggggcc
atctcagtcacacctgaccatgagccatgtggcaccgtcttggaagcggccaagaaggct
ggttacatgacgggcctcgtggtcacgacacgcatcacagatgcaacacctgcatgcttt
gcggcacatgtcaacatgcgctccgaggaggaccgcattgccgagcagatggtcggagag
catcctctgggccgtgttgtggatctcatgtttggcggcggaagatgccacttccttccc
aactcgaccattgactcgagctgtcgtgcagacggcaaggatgtcattggcttggccaag
aagaatggcttcagctacatctctgaccgcgctggtttcgacaagctcaagcagggagcg
aatgtcgacatgcccatgctgggactcttcgccgatacagacattccatatgaaatcgac
cgtcgcaacgagaaccatgtttaccccagtctgcacgagatggctgaggcggccatgcgc
gcactcagtgatgccacgcgggacagtgacaagggtttcttcctgatgattgaaggctcg
agaatcgaccatgcaggccaccacaacgaccccgcagcccaagtgcacgaagttcttgcc
tacgaccgagccttcaacagcgtgctcgacttcatcaagcgcgaaacgacacagacggtc
atggtatctacatcggaccacgagacgggcgggctcgctgttgcgcgccaacttcacacg
tcctacccagagtacgcatggtacccctccccgctcgcaaatgcctctcactctgccgaa
cgcctcgctctcctctacgccaaacatcttctgagcggtccgacaccagatcaaaaagcc
gacttcgtccgtgactccattagcaacggactcggcatcaacgactacaccgacgaagaa
gtgcagaacctcgtcaagacgccagacacggctctataccaatacgcagacatgatgtcg
cggcgcagtcaaaccggctggtcgacccatggccacagcggcgcagatgtgaacatctac
tcatcagatcctaaagctgctaccgcgcttgtgggtaaccatgagaatactgaagtcggt
gacttcctccgtgactacttggctgtggatgtggaagcggttaccaaggaacttaggcaa
aagggcaagggcttcatggtgcagataatcaatgataccgagattagttggattggaaaa
gtaccggttgacggagagaggttggatggacagacgcatctggcgagttactcgggggat
cacaagaagagaaatctaggctccgtgcatggtgacgactgtggatgcgggcattga

DBGET integrated database retrieval system