KEGG   Pyrenophora teres: PTT_15756Help
Entry
PTT_15756         CDS       T01613                                 

Definition
(GenBank) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
pte  Pyrenophora teres
Pathway
pte00020  Citrate cycle (TCA cycle)
pte00190  Oxidative phosphorylation
pte01100  Metabolic pathways
pte01110  Biosynthesis of secondary metabolites
pte01130  Biosynthesis of antibiotics
pte01200  Carbon metabolism
Module
pte_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pte_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pte_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:pte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PTT_15756
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PTT_15756
Enzymes [BR:pte01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PTT_15756
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 GIDA FAD_binding_3 Pyr_redox_2 Lycopene_cycl DAO HI0933_like
Motif
Other DBs
NCBI-ProteinID: EFQ88384
UniProt: E3S0W4
LinkDB All DBs
Position
Unknown
AA seq 716 aa AA seqDB search
MRNCVRSVRRALHSTCHGSFPTSRLNRSFATVKSPNIKDFTVIDHHYDAIVVGAGGAGLR
AAVGLTEQGLKTACISKLFPTRSHTVAAQGGINAALGNMCKDDWRWHMYDTVKGSDWLGD
QDAIHYMTREAVPAVVELENYGMPFSRTSKGTIYQRALGGQSLEYGKGGQAYRTACAADR
TGHAMLHTLYGQSLKEGVQFFIEWFALDLMMSEGKCVGITAMNMEDGTFHRVFARNTVLA
TGGYGRAYFSATSAHTSTGDGNAMVSRAGLPLQDMEFVQFHPTGIFGAGVLITEGARGEG
GYLLNGEGENFMHRYAPLARDLASRDVVSRSMNLEILKGRGCGPDKDHIYLQLSHIPRDV
IMERLPGILETAAIFAGIDIIRQSIPVIPTVHYCMGGIPTNYHGQVLNVEKGDDEKENVI
GGLYAAGEAACVSVHGANRLGANSLLDIVVFGRAAALHISTHNAPSTPHNASPSTIGLDS
ITAIKSLLTSTGTTAPSTIRTSMQKTMQSTASVFRTHNTLSSGSTSLAALSRTYTASLSL
TDRSLIWNTDLIEALELRNLLTNAEQTVAAALARKESRGAHARDDFKERDDEEWLVHSLT
WQGDVGESVRLGKRGVQLKTLDEAEVASVGNSQNFFPLTPSLLLSTSTSTVFSSNLPILP
APPFPHDICLFFLPASLDPFPDPVPIDPVVPTEADLDFKQPDTEDEELELRGRETG
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaattgcgtgcgaagtgtcaggcgcgcccttcatagcacctgccatggctccttc
cctacttcaagactaaacagaagctttgcaacagtgaaaagtcctaatatcaaagacttt
acagttattgaccaccactacgacgctatcgtcgtcggagcaggaggagcaggtctccgc
gctgccgtcggactcacagaacaagggctaaaaacagcatgtatatccaagctcttcccc
acacgatcccacaccgtcgcagcgcaaggcgggatcaacgccgcgctcggaaacatgtgt
aaggatgattggcgttggcatatgtacgatactgtcaaaggttccgattggctcggagac
caagatgccatacactacatgacgcgtgaagccgtgcctgcagttgtcgagctggaaaat
tacggtatgcctttcagccggaccagtaaaggaacaatctaccaacgagcactcggcggt
cagagtctagagtatgggaaagggggacaggcgtataggacggcgtgtgcggcagatcgg
acgggacatgcgatgcttcatacgttgtatgggcagagtttgaaagagggagtacagttc
tttattgaatggtttgcgctggatttgatgatgtctgagggcaagtgtgtgggtattacg
gcgatgaatatggaggatgggacattccatagagtgtttgccagaaatacggtactggct
actgggggatatggacgcgcatactttagcgcaactagcgcccatactagtactggagat
ggtaatgccatggtctctcgggctggtctaccgcttcaagatatggagtttgtgcaattt
catcctactgggatttttggcgcaggagttctcatcacagaaggtgctcgaggcgaaggc
ggctatcttctcaacggtgaaggcgaaaacttcatgcatcgctacgcccccttagcaaga
gatctagcctcccgcgacgtagtctcacgtagcatgaacctcgagatattaaaaggacgc
ggctgcggacccgacaaagaccacatctatctccaattatcccacatccctcgggacgtc
ataatggaacgactaccaggcattttggaaacagctgcgatctttgcaggaattgacatt
attcggcaatcaatccctgtgataccaaccgtacattactgcatgggcggcataccaaca
aactaccacggccaagtcctaaacgtcgagaaaggcgatgatgaaaaagagaatgtgatt
ggcggattatacgcagcaggagaagcggcatgtgtcagtgtacacggcgcaaaccgacta
ggtgcaaattccctcctcgacattgtagttttcggccgcgcagccgccctccacatatcc
acccacaacgccccctcaacaccgcataacgcctccccttccaccatcggcctcgactcc
ataaccgccataaaatccctcctcacatccactggcacaaccgcgccatccaccattcgc
acctcgatgcaaaaaaccatgcaatcaaccgcctccgttttccgcacacacaacacgctc
tcctccggcagcacctccctcgccgccctctcgcgtacctacacagcctctctttccctc
accgaccgcagtctaatctggaacacagatctcatcgaagcgctcgaactgcgcaattta
ctaacgaacgcggagcagacagttgcggcggcgttggcaaggaaggagagtaggggtgcg
catgcgagggatgatttcaaggagagagatgatgaggagtggttggtgcatagtttgact
tggcagggggatgtaggggagagcgtgaggctgggaaagaggggggtgcagttgaagacg
ttggatgaggcggaggtggctagtgtggggaacagccaaaactttttccccctcaccccc
tcactactcctctccacctccacctccacagtattctcatccaacttgcctatattaccc
gccccaccctttccccacgacatatgcttgttcttcttacccgcctcactagaccccttt
ccagatcccgtacccatcgatcccgtcgtacccaccgaagccgatctagactttaaacag
ccagacacggaagatgaagaactagagctacgaggtcgggaaactggatag

DBGET integrated database retrieval system