KEGG   Pyrenophora teres: PTT_17200Help
Entry
PTT_17200         CDS       T01613                                 

Definition
(GenBank) hypothetical protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pte  Pyrenophora teres
Pathway
pte03030  DNA replication
pte03410  Base excision repair
pte03420  Nucleotide excision repair
pte03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pte00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    PTT_17200
   03410 Base excision repair
    PTT_17200
   03420 Nucleotide excision repair
    PTT_17200
   03430 Mismatch repair
    PTT_17200
Enzymes [BR:pte01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PTT_17200
    6.5.1.6  DNA ligase (ATP or NAD+)
     PTT_17200
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     PTT_17200
DNA replication proteins [BR:pte03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    PTT_17200
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     PTT_17200
DNA repair and recombination proteins [BR:pte03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     PTT_17200
   NER (nucleotide excision repair)
    Other NER factors
     PTT_17200
   MMR (mismatch exicision repair)
    Other MMR factors
     PTT_17200
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: EFQ87336
UniProt: E3S3V7
LinkDB All DBs
Position
Unknown
AA seq 909 aa AA seqDB search
MPPKQATLGKFFGKANGDGAKQQSKLSFSTKPRPVKKEVPQSSPEDVKKEHKDEVDSDAD
VKAPVKEEVEADADADAMEVDSTTSETGKKRQIKEGEEAESEEEPPSKRQRRKPSEEKEK
PKKKTAVKPKAEKSPAKSKKATAKSSSPEPEDEDVSAPTKVAKGKKKAAAKPKAAEVDDG
EAAAPAKVAKGKKKEIEKSPAPAEDEVDSNKEEEDVLSSEEEEVKVKARKQVQTTLASNT
KDPYPDWKPGEPVPYAALCTTFSKIEMTTKRLEILAHCSLFLRQVLRLTPKDMLPTVMLM
VNKLAADYAGIELGIGESLIMKAVSESTGRNLQQIKTDQNEIGDLGLVAAKSRSKQPTMF
KPKALTVEGVRKGLMGIATVEGQGAQGRKVDGIKKLLSAADAHNSGKAIDIDKDKGGPSE
AKFIVRTLEGKLRLGLAEKTVVVAVAQAMIFHEMSLEGKTPSTTDLGKAEAMLKTVYSEL
PSYEVIIPAMLEHGIMNLRENCRLQPGVPLKPMLAKPTKSITEVLDRFEGKDFTCEYKYD
GERAQIHFVAHDADMELATAAPTAGRSDRGVSNIFSRNSEDLSKKYPDILAKLPTWVKEG
TKSFVLDCETVAWDMVEKKVLPFQQLMTRKRKDVKVEDVKVKVCVFAFDLLYLNGEALVT
KSFRERREHLNEAFIPVEGEFALAKFGNTNELEEIQTLLEDSVKEGCEGLMVKMLDGPES
FYEPSKRSQNWLKVKKDYLAGVGDSLDLVVLGAYYGKGKRTSWYGAFLLACYNPKTEKYE
TVCNIGTGFSEVILESLHKTLSEIVIDRPKPFYTHSTGNKDQPDVWFEPRHVWEVKTADL
TLSPRYKAAADEVGGGGKGVSLRFPRFIKERDDKKPDEASSSRMIAEMYQRQESVGKNKG
PSVDDDFEY
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
atgccgcctaagcaggctactcttggaaagttcttcggcaaggccaacggcgacggagcg
aagcagcagtcgaaattgtcattctccaccaagcccaggcccgtgaagaaggaggtgcca
caatcctcgccagaagatgtgaagaaggaacataaagacgaagtcgattccgatgcagac
gtcaaagcaccagtcaaggaagaggtagaagccgacgccgacgccgacgccatggaggtt
gacagtacaacatcggagactggaaagaagaggcaaatcaaggagggggaggaagcagag
tcagaagaggagccgccgtcaaagcgtcaacggaggaagcctagtgaggagaaggagaag
ccaaagaagaagaccgctgtgaagccaaaggccgagaagtcacctgcaaaatccaagaaa
gcgactgcgaagtctagttctccagagccagaagacgaggatgtctctgcgccgacaaag
gtagcgaagggcaagaagaaagccgctgccaaacccaaggccgctgaggtggacgacggc
gaggcagcggcacctgcgaaggttgcaaagggcaagaagaaggagattgaaaaatcacca
gcaccagcagaggatgaagttgactcgaacaaggaggaagaggacgtgcttagctcagag
gaagaagaggtcaaggtcaaggcgcgaaagcaagtacaaactacacttgcgtccaacacc
aaggacccatacccggactggaaaccaggcgagccagtgccgtacgccgcactctgcaca
accttctccaagattgaaatgactacaaagcggttagaaatcttagcgcactgttcgttg
ttcttgcgacaagtattgcgattaacaccaaaggatatgctgccaactgttatgctcatg
gtcaataagcttgcagccgactacgcaggcattgaactcggtatcggcgagtctttgatc
atgaaggctgtgtctgagagtactggaagaaatctacaacagatcaagactgaccagaac
gagattggtgatctgggtctggtcgcagcaaagagtcgatccaagcagccaaccatgttt
aagcccaaggctttgacagtggagggtgtacgtaaaggtctgatgggcattgccactgta
gaaggacaaggtgctcaagggcgcaaggttgacggcatcaagaagttgttgtcggcagca
gacgcgcataactctggaaaggccatcgacatcgacaaggacaaggggggtccaagtgag
gccaaattcattgtacgaacattggaaggcaagcttcgattgggtcttgccgagaagact
gtggtagtagctgttgcacaggccatgatcttccatgagatgtctctggaaggcaagaca
ccgtcgacaacagatttgggaaaagcggaagccatgctgaagactgtctacagtgagctt
cccagctacgaagtcatcattccagcaatgctcgagcatggcatcatgaacctgcgcgag
aactgccgcctacaacccggtgttccgctcaagcctatgcttgccaagccgacaaaatca
attacagaggtactagatcgcttcgaaggcaaagacttcacatgtgagtacaagtacgat
ggagagcgggcccagatacattttgttgcacatgatgcagacatggaattagcgaccgca
gctcctactgccggtaggagtgatcgtggcgtatcgaatatcttctccagaaactccgaa
gacctgtcgaagaagtaccccgatatccttgccaagttaccaacttgggtcaaagaaggt
acgaagagctttgtgctggactgtgagactgttgcgtgggatatggtggagaagaaggtg
ttgcctttccagcagcttatgacacgtaagaggaaggacgtcaaggttgaggatgttaaa
gtcaaggtctgcgtctttgcctttgatctactctacctgaatggcgaggcacttgtaacc
aagtctttccgcgagcgtcgtgagcatctcaacgaagccttcatcccagtcgaaggagaa
ttcgctctcgccaaattcggcaataccaacgaactagaagagatccaaacgctcctcgaa
gactctgtcaaagagggctgcgaaggtctcatggtcaagatgctcgacggcccagaatcc
ttctatgagccctccaagcgatcgcagaattggctcaaagtgaagaaagactacctcgcc
ggtgtcggcgactccctcgatctcgtggtgctgggagcctactacggcaaaggcaagcgc
acaagctggtacggtgccttcctcctcgcatgctacaaccccaagacggaaaaatacgaa
acagtttgcaatatcggcactggtttctccgaagtcatactcgaatccctccacaagacg
ctttcggaaatcgtaatcgaccgcccgaagcccttttacacgcattcaacgggcaacaag
gaccagcccgacgtctggttcgagccgagacatgtctgggaagtcaagacagcggatctc
acgctcagtcctaggtacaaagcagcggcggatgaggtgggtgggggtggcaaaggtgtg
agtttgaggtttccgaggttcatcaaggagagggatgataagaaaccggatgaggcgagc
tcgagtcgtatgattgcggagatgtatcagaggcaggagagtgtgggaaagaacaaggga
ccgagcgttgacgacgattttgagtattga

DBGET integrated database retrieval system