KEGG   Pyrenophora teres: PTT_17563Help
Entry
PTT_17563         CDS       T01613                                 

Definition
(GenBank) hypothetical protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
pte  Pyrenophora teres
Pathway
pte00052  Galactose metabolism
pte00500  Starch and sucrose metabolism
pte01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    PTT_17563
   00500 Starch and sucrose metabolism
    PTT_17563
Enzymes [BR:pte01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     PTT_17563
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-ProteinID: EFQ87041
UniProt: E3S4P9
LinkDB All DBs
Position
Unknown
AA seq 1052 aa AA seqDB search
MDPENAAFGQSNEYKKTAWLRWAFTDASLPEDLQKAFDRLILTIMSRSGLTFLSSLLALT
TAQIPTSSESGWSTTLAGTPTSFRSVFTLPPLVDEGVQQIPNIYDPEAVNAQHVCPGYKA
SDLKKSDRGLSATLTLAGKACNAYGTDIEELDLKAEYQAKGRLAVSIVPKYLGAKNQSQW
MVPEDLIPRPQAEDSYKDTDLKFDWGNEPSFWFNVGRHSTGDVIFTTEGSKLIYENQFIE
FVNSLPEDYNLYGLGERITGLRLNNNFTATIYAADVGDPIDRNLYGSHPFYLETRYFEKG
SNAGNVPLKQSEIQQPSVGSDDKPTGSAYESRSHGLYYRNTHGMDVVLKPDHLSWRTLGG
AIDLFFYDGPSQPEVTKEYQRSAVGMPAMQQYWTFGYHQCRWGYRNWTELREIVETLRTF
KIPMETIWLDIDYMDQYRDFTVDPVSFPSSEVADFFGWLHGNNQHFVPIVDSAVYIPNPQ
NASDAYDTYTRGNNSGVFLNNPDGSQYIGAVWPGYTVFPDWMSSNGVSWWVKEMVEWYKE
VPFSGFWLDMSEVSSFCVGSCGTGNVTLNPVHPPFSLPGETGNIIYDYPEGFNITNSTEA
ASALAASSSQALSTKATTALSVSPTPTVSTTSYFRSTPTPGVRNINYPPYVINHVQDGAD
LAVHAVSPNATHANGIEEYDVHNLFGHQIINATYQGLLSVFPGKRPFIIGRSTFAGSGKW
AGHWGGDNASKWAYMFFSIPQALSFSLFGIPMFGVDTCGFNGNTDMELCARWMQLSAFFP
FYRNHNVLSAIPQEPYRWEAVASASRTAMHIRYTLLPYIYTLFNDAHKTGSTVMRALAWE
FPNEPQLAGVDTQFLLGPNILVTPVLEPQVDTVKGVFPGIVDGETWFDWYSGERVQAAAG
VNTTISAPLGHIPVYIRGGSVLPTQEPGYTTAESRKNPWGLIVALSSTGTASGSLYIDDG
ESLEPESCLDVTFNVMNGKMKADVQGEYKDTNALANVTILGAPTAHQVKLNGATIDAANM
NYNQTSKVLKLTGLNDMTSEGAWEKGWILTWE
NT seq 3159 nt NT seq  +upstreamnt  +downstreamnt
atggacccggagaacgctgcatttggccaaagcaacgagtataagaagacagcatggctt
cgatgggcattcacagacgcaagcttgcccgaggaccttcagaaagcatttgacagactg
attctgaccatcatgtcgcgctcaggtctcacgttcttgtcttctcttttggcattgaca
actgcccagatacctacctcctctgaaagtggctggagcactacgctcgctggcacacca
acctcgttccgatcagtttttactcttcccccgttggtggatgaaggtgtccaacagatt
cccaacatctacgaccccgaagccgtcaatgctcaacatgtctgcccaggctacaaggca
tctgacctcaagaagagtgaccgtggtcttagtgctacattgaccctggctggaaaggct
tgcaatgcctacggtactgacattgaagagctcgacttgaaggccgagtaccaagcaaag
ggaagattggccgtcagcattgtgccaaaataccttggtgcaaagaatcaatcccagtgg
atggtgcccgaagacctcattccgcgaccgcaggccgaggattcttacaaagacacagac
ctgaaattcgattggggcaacgagccatcgttttggttcaatgtcggccgtcactctacg
ggagatgttatcttcactaccgagggctccaagctcatctatgagaatcaattcatcgag
tttgtcaacagtctgccagaagactacaacctatacggccttggcgaacgaatcactggt
ctccgtctgaacaacaactttacggccaccatctatgctgcggatgttggtgatccaatc
gaccgcaacctttacggcagtcatccattttacttggagacgcgctacttcgagaaaggc
agtaatgccggcaatgtacccctgaagcaatctgaaatccaacagccaagcgtcggaagc
gatgacaagcccacaggttccgcttacgagtcacgttcgcatggtctctactatcgaaac
acacatggcatggatgttgtcctaaagcctgaccatttgtcatggaggaccctcgggggc
gcaatcgatctgttcttctacgacggaccctcacagccagaagtgaccaaagaataccag
aggtcggcagtcggtatgcccgccatgcagcagtattggacttttggttaccatcagtgc
cgatggggataccgcaactggaccgaactaagagagattgttgagactttgagaactttc
aaaattcccatggagaccatttggctcgacatcgactacatggatcagtacagagacttt
accgttgatcctgtgtcttttccttcctctgaggtcgcagacttctttgggtggctccat
ggcaacaaccagcactttgtccccattgtcgattcggctgtctacatacccaatccacag
aatgcgagcgacgcgtacgatacctacacccgtggcaataactcaggcgttttcctcaat
aaccctgatgggagccagtacattggtgctgtctggcccggctacaccgtgttccccgat
tggatgtcttctaatggtgtctcgtggtgggtcaaagaaatggtcgagtggtacaaggag
gtgccattcagtggcttctggcttgatatgagtgaggtgtcctcgttctgtgtcggctcc
tgcggcacaggtaacgtgacgctcaacccagttcacccgccattttctcttccaggcgag
acaggcaacatcatttacgactaccctgaaggatttaacatcaccaactcgactgaagct
gcttctgctttggctgcttcctcgagccaggccttatctaccaaggcaactacggctttg
tcagtgtcgcccacccccacggtctccactaccagctattttcgctctacgcctacaccc
ggtgtacgaaacatcaattatcctccctatgtcatcaatcatgtacaggacggtgctgac
ctcgccgtccatgctgtcagccctaatgcgacacacgcgaatggcatagaagagtacgat
gttcacaacctctttggacatcagattatcaatgctacctatcaaggtcttctttctgtt
ttccctggaaagcgtccattcatcatcggacgttccacatttgctggtagtggcaagtgg
gccggtcactggggtggtgacaacgcctccaagtgggcctacatgttcttctccattcct
caggctttatcgttctccctgtttggtattcccatgttcggagtagacacctgcggcttc
aacgggaacactgatatggagctttgcgcccgctggatgcagctatcagctttcttcccc
ttctaccgcaaccacaatgtgctgtccgctattccacaggagccgtaccgttgggaggct
gtagcttcagcatcgaggactgcgatgcatatccgctacactctacttccttacatatat
accctcttcaacgacgcccacaagacgggatccacagttatgcgagcgttggcatgggag
ttccccaacgagcctcagcttgctggtgttgacacacagttcttgttgggtcccaacatc
ttagtcactccagtccttgagccacaagtcgacactgtcaaaggtgttttcccgggtatc
gtagatggagagacatggttcgattggtactctggtgagcgcgttcaggccgcagccggc
gtcaacactaccatctcagcgcctttgggccacattcctgtctatatacgtggcgggtcc
gtactaccaactcaagagcctgggtacactactgcagaatcacgtaaaaatccttggggc
ctcatagtcgcactttcgagcacaggaactgcatctggtagcctgtatattgatgatgga
gagtctcttgagccggagtcctgcctggatgtcacatttaacgtcatgaacggaaagatg
aaggctgacgtccaaggcgaatacaaggacacaaacgcacttgccaacgtcacaatctta
ggcgcgccaactgctcatcaagtcaagctcaacggtgcgaccattgatgcggcaaacatg
aactacaaccaaaccagcaaagtattgaagcttacaggtctgaatgacatgacaagtgaa
ggggcttgggagaagggctggatcctgacctgggaataa

DBGET integrated database retrieval system