KEGG   Pyrenophora teres: PTT_17650Help
Entry
PTT_17650         CDS       T01613                                 

Definition
(GenBank) hypothetical protein
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
pte  Pyrenophora teres
Pathway
pte03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:pte00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    PTT_17650
Enzymes [BR:pte01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PTT_17650
DNA repair and recombination proteins [BR:pte03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     PTT_17650
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_N DNA_ligase_A_M BRCT_2 RNA_ligase DNA_ligase_A_C LIG3_BRCT BRCT Bac_globin
Motif
Other DBs
NCBI-ProteinID: EFQ86998
UniProt: E3S4W2
LinkDB All DBs
Position
Unknown
AA seq 988 aa AA seqDB search
MTEDTPMPDADAIRENTLMYGHDDDLDDKYPTRPINLHKTLPFHTLFTDLFNPLMETQKR
KQPAGARRRVGPHGHSNMSPHEAKRNIIQRFIANWRKQVGNDFYPAMRLIIPEKDRDRAM
YGLKEKAIAKVLIKLTRIGKDSDDAKHMLNWKLPGQLNKASASTAGDFAGRCYEILSTRQ
LKTEYSDMTIAEVNNALDRLSQVGAEDEQVKIFQRFYRRMNAEEMTWLIRMILRQMKIGA
TEKTFLDIWHPDAETLFNISSNLRRVCWELFDIELRLQGEDTGLSLMQCFQPQLAQFQDK
VGSFEKLVTRFKGDENDDTFWIEEKLDGERMQLHMMEDPDAPGGKLFGFWSRKAKDYAYL
YGRHFDGDEAGALTRFITDAFGENVRNIILDGEMITWDMETDHIVGFGTLKTAALSEKEN
KTNKNTGQRPLFRVFDCVYLNDKLLTQYTLRDRRRALESAVKGVTRRLEVHPYIEARSHT
EIEPALRKVIAESSEGLVLKNPRSMYCLNQRNNDWMKVKPEYMSEFGESLDCIVVGGYFG
SGHRGGVHSSFLCALLTDKDAKPGDPKYEHCWSFFKVGGGFSREDYAAIRGRTEGKWHNW
DRRRPPPFIELGGHEQNRQHERPDQWIRPSDSVVLECKAASVESSDKFRSTLTLRFPRFK
LLRVDKRWDQALSIQEFLDVKSRAEKEKSEKEKEFKIEQSRRKKARTTKKPLTVVGDDAV
ITPYAGAVSKVFEGLTFYIMTEQVHPSKKSKADLEALVKANGGRLIQRDTTAKDLVIVAD
KRLIKVASLEKRGTNNIVKPIWLQDCIMQNERDAGAPPYLLPFEPNRHMYYLHDDDQMDY
EANLDDNGDSYARDITDVDEMRRLLDGVEIPKSKFSRDAFLEQLEGHGEDFSQFKTYMFQ
NVKAKFSGEVGSELRVRLAKNYVRFGGGQVADGGDEEGVTHVVVADGQTSAAKGKARVNG
LARVVGLGWIEKCWEEGTRIDEERFQWG
NT seq 2967 nt NT seq  +upstreamnt  +downstreamnt
atgacggaagataccccaatgcccgacgcggacgcgattagggagaacaccctcatgtac
ggccacgatgacgacctcgatgataaataccctaccaggccgataaacctccacaaaaca
ttgccttttcacacgctattcactgacctcttcaatccgctcatggagacgcagaagagg
aagcagccagcaggggctcgtcggcgagttggtccacacggacactccaacatgtcgccc
catgaagccaagcggaacatcattcaaaggttcatcgcaaattggcggaagcaggtcggc
aacgacttctacccggcaatgcgactcatcatacccgagaaagaccgtgatcgggccatg
tacggcctgaaagagaaggcaattgcaaaggtgttgatcaaactcaccagaatcggcaag
gactcagatgatgccaagcacatgctcaattggaaactgcccggccaactcaacaaggct
tcagcttccacagcaggtgactttgcagggagatgctatgagattctgtcaacacgacaa
ctcaaaaccgagtacagcgacatgacaattgcagaagtcaataatgcactggatagactg
tcgcaggttggtgccgaggatgagcaagtcaagatcttccagagattctatcggaggatg
aatgctgaagagatgacttggctgatccgtatgattctacgtcagatgaagattggtgca
acggagaagacgtttcttgacatatggcatccagacgcagaaacactcttcaacatatct
tcgaacctccgacgcgtgtgctgggagctcttcgacattgagcttcgactacaaggtgaa
gatactggtcttagtctgatgcagtgttttcaaccccagttggctcagttccaagacaag
gttggttctttcgaaaagctcgtcacgagattcaagggagatgagaacgatgataccttc
tggattgaggagaagctcgacggagagagaatgcagcttcatatgatggaggatccagac
gcgccaggcgggaagttgttcgggttctggtcacgcaaggcaaaggactacgcatatcta
tatggtcgacatttcgacggcgacgaggctggtgcactgacacgcttcatcaccgacgcg
ttcggggagaatgtcaggaacatcatcttggatggcgaaatgatcacatgggacatggaa
actgaccacattgtcggctttggtacactgaagacggcagctttgtctgaaaaggagaac
aagacgaacaaaaatacgggccaacggccgctgttccgagtattcgattgcgtttatctc
aacgacaaactactcacacagtacacactacgtgatcgccggcgtgctcttgaaagcgct
gtcaaaggcgtgactcgaagactggaagttcacccatacattgaagcacgctcacacacc
gagatcgagccagcactgcgcaaggtcatcgcggaatcttccgaaggtcttgtactcaag
aacccccgttcaatgtactgcctcaaccagcgcaataacgactggatgaaggtcaagcca
gaatacatgtcagagtttggcgaatcgctcgattgtatagttgtcggtggatacttcggg
tccggccatcgtggtggtgtgcactcgtccttcttgtgcgcgttactgacggacaaggac
gcaaagccgggtgatccgaaatacgagcattgttggtcatttttcaaagtcgggggcgga
ttcagtcgcgaggactatgctgccatacgaggtcgaacagagggaaaatggcacaactgg
gatcgtcgacgaccaccaccattcatcgagctgggcggccacgaacaaaatcgtcaacac
gagcggccagaccaatggatccgaccgagcgattcggtggtcctagaatgcaaagccgcc
agcgtagaaagcagcgacaaattccgctccacattaaccttacgcttcccccgcttcaag
ctcctccgcgtagacaagcgctgggatcaagccctctccatccaagaattccttgatgtc
aaatcccgagcagaaaaagagaagtcagaaaaggagaaagagttcaaaattgaacagtcc
cgccgcaaaaaggctcgcacgaccaagaaaccgctcaccgttgttggcgacgacgcagtt
ataaccccgtacgcaggcgcagtatccaaagtctttgaaggcctaactttttatataatg
accgagcaagtccacccaagcaagaaatcaaaagcggacctagaggccctcgttaaagcg
aacggaggaaggcttatccagcgcgataccactgccaaagaccttgtcattgttgcagac
aagcggctcatcaaagtcgcttcgcttgaaaagcgcggcacaaataatatcgtcaagccc
atttggctacaggactgcataatgcaaaacgagcgagatgccggtgcaccgccttacctt
ctccctttcgaacctaacagacacatgtactacctccacgacgacgaccaaatggactat
gaggccaatcttgatgataatggagattcatatgcgcgcgatatcactgatgtggatgaa
atgcggaggttgcttgacggggtggaaatcccgaagagcaagttcagccgagatgcattc
ttggaacaacttgaggggcatggagaggatttttcgcagttcaaaacgtacatgtttcag
aacgtcaaggcgaaattctctggggaagtggggtcagaactgagagtaagactggcaaag
aactatgtgaggtttggaggcgggcaggttgcagatggtggggatgaagagggtgtaacg
catgttgttgtagcagatggccaaacttcagcagcaaaggggaaagcgagggtcaatggc
cttgctcgcgtagtcggactgggatggattgaaaagtgttgggaagaagggactcgtatc
gacgaggagagattccaatggggttga

DBGET integrated database retrieval system