KEGG   Pyrenophora teres: PTT_17761Help
Entry
PTT_17761         CDS       T01613                                 

Definition
(GenBank) hypothetical protein
  KO
K10967  alpha 1,2-mannosyltransferase [EC:2.4.1.-]
Organism
pte  Pyrenophora teres
Pathway
pte00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:pte00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    PTT_17761
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pte01003]
    PTT_17761
Enzymes [BR:pte01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     PTT_17761
Glycosyltransferases [BR:pte01003]
 Glycan extension
  Yeast mannan chain
   PTT_17761
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_15
Motif
Other DBs
NCBI-ProteinID: EFQ86964
UniProt: E3S585
LinkDB All DBs
Position
Unknown
AA seq 409 aa AA seqDB search
MAGSQRYLRYIVFAVVSIALLYFIGSSSTVPSPNWPVYQDSKTPATGNAAVGNDEVKPPT
DKAPSEAPPKTTPNQHSLPPPTDAGKRMNATFVTLARNSDVWDIAKSIRQVEDRFNRKFN
YDWVFLNDDDFDDQFKKVTTALVSGKTKYGKIPKEHWSFPEWIDQQKAAEVREQMKEKKI
IYGDSISYRHMCRYESGFFFRHPLMLDYEWYWRVEPSVELYCDINYDTFKFMADNKKKYS
FTLSLYEYIETIPTLWDATKNFTKHFPQHIAKDNAMKFLSDDGGETYNKCHFWSNFEIGN
LNWLRSDAYIDFFTSLDQAGGFFYERWGDAPVHSIAAGLMLQKDEIHFFNDIAYYHVPFT
HCPTGEQYRLDHKCHCDPKNNFDWNGYSCTARFYEMQGMQKPIGYEKEQ
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggccggcagtcagcgctatctccgctatatcgtctttgcggtagtgtccatcgccctc
ctctacttcatcggctcctcgtcgaccgtgccttctccaaactggcctgtctaccaggac
tccaaaacgccagccactggaaatgccgccgtcggaaacgatgaggtcaagccacccact
gacaaggcgccctctgaagcgcctcccaaaaccacacccaaccaacactcgctacccccg
cccaccgatgctggaaagcgcatgaacgccacctttgtcacgctcgctcgcaactcggac
gtgtgggacattgccaagtcaatccgccaagttgaagaccgcttcaaccgcaagttcaac
tacgactgggtctttctcaacgacgacgatttcgatgatcagttcaaaaaggtcacaact
gcgctcgtgtctggcaagaccaagtacggaaagatccccaaggagcactggtccttcccc
gaatggattgaccagcaaaaggctgccgaggtccgcgagcaaatgaaggagaagaagatc
atctacggtgactccatcagctacaggcacatgtgccgttacgaatccggcttcttcttc
cgtcacccgttgatgctcgactacgagtggtactggcgtgtcgagcccagcgtcgagctg
tactgcgacatcaactacgataccttcaaattcatggccgataacaagaagaagtacagc
ttcaccctcagcttgtacgagtatattgagacgattcctaccctttgggacgccaccaag
aacttcaccaagcacttcccccaacacatcgccaaggacaacgcaatgaagttcctcagt
gacgacggcggcgagacgtataacaaatgccatttctggtccaactttgaaattggtaac
ctcaactggctgcgctccgacgcatacattgatttctttacttccctcgaccaggctggt
ggcttcttctacgagcgatggggcgatgctcctgttcactccattgcagccggtctgatg
ctacaaaaggacgaaatacactttttcaacgacatcgcctattatcacgttccctttacg
cactgccctactggcgagcaatatcgcctggaccacaagtgccattgcgaccccaagaat
aactttgactggaacggctacagctgcacggcacgattctacgagatgcagggtatgcag
aaacctattgggtacgaaaaggagcaataa

DBGET integrated database retrieval system