KEGG   Pyrenophora teres: PTT_18777Help
Entry
PTT_18777         CDS       T01613                                 

Definition
(GenBank) hypothetical protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
pte  Pyrenophora teres
Pathway
pte00010  Glycolysis / Gluconeogenesis
pte00051  Fructose and mannose metabolism
pte00052  Galactose metabolism
pte00500  Starch and sucrose metabolism
pte00520  Amino sugar and nucleotide sugar metabolism
pte01100  Metabolic pathways
pte01110  Biosynthesis of secondary metabolites
pte01130  Biosynthesis of antibiotics
pte01200  Carbon metabolism
Module
pte_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pte_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pte00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PTT_18777
   00051 Fructose and mannose metabolism
    PTT_18777
   00052 Galactose metabolism
    PTT_18777
   00500 Starch and sucrose metabolism
    PTT_18777
   00520 Amino sugar and nucleotide sugar metabolism
    PTT_18777
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    PTT_18777
Enzymes [BR:pte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     PTT_18777
Membrane trafficking [BR:pte04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    PTT_18777
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-ProteinID: EFQ86060
UniProt: E3S7H2
LinkDB All DBs
Position
Unknown
AA seq 485 aa AA seqDB search
MADMPKDLKTQIDKLEELFVVNTDKLKHITNHFVSELEKGLSEEGGSIPMIPTWCMAFPD
GNETGSYLALDMGGTNLRVCEVTLTEEKGEFEIIQSKYRMPEELKTGTADELWGYVADCL
QQFIEYHHEGEKLETLPLGFTFSYPVSQDAIDHGVLQRWTKGFDVHGMEGVDVVPGFKKA
LEDRGVPIKLAALVNDTTGTMIASAYTNTSIKIGCIFGTGCNAAYMEECGEIPKLKHMKL
DPKLPMAINCEWGAFDNEKKVLPRTQYDVIIDKESPRPGQQLFEKMVAGLYLGEIFRLVL
LDLHKGNECSMFEGQNASKLTKPYSLDAGFLSQIEEDRFENLQDTADLFQEKLGITCTKP
ELELIRRLAELIGTRAARLTACGVSAICKHKHWDEVHVGADGSVFTKYPHFKIRQAQAMK
EIMDWPAKYGKGKNDPIEVLPAEDGSGVGAALIAALTVKRAQQGLLAGIRDQDALLAMAP
KKKGN
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggcggatatgcccaaggatctgaagacgcagattgataagctggaagagctgtttgtc
gtaaacacagacaagctgaagcacatcacgaaccactttgttagcgagctcgagaagggc
ttgtcagaagagggaggaagcattcccatgattcccacttggtgcatggctttccccgac
ggcaacgagaccggcagttaccttgcgctcgacatgggcggcaccaacctgcgcgtctgc
gaagtcaccctgactgaagaaaagggcgaatttgagattatacaatccaagtaccgcatg
cccgaagagttgaagacgggaaccgccgatgagctttggggatacgttgccgactgtctg
caacagtttatcgaataccaccacgagggcgagaagctcgaaaccctgccgctcggattc
accttttcataccccgtctcgcaagacgctatcgatcatggtgtcctacagcgatggacc
aagggcttcgatgttcacggcatggagggcgtggatgtcgtgcccggcttcaagaaggcg
ctggaagaccgtggcgtgcccatcaagctcgcagctttggtcaacgacacaaccggtacc
atgattgcctctgcatacacaaacaccagcatcaagattggttgcatcttcggcactggc
tgcaacgctgcctacatggaagagtgcggcgagatccccaagctgaagcatatgaagctt
gacccgaagctgccaatggccatcaactgtgaatggggcgcgttcgacaacgagaagaag
gtcctccccaggacacaatacgacgttattattgacaaggagtcaccacgacccggccag
caattgttcgagaagatggtcgcaggtctatacctgggagaaatcttccgtctagtcctc
ctggatctacacaagggtaacgagtgttcaatgttcgaaggccaaaatgccagcaagctc
accaaaccctactcgctcgatgccggtttcctctcgcaaatcgaggaggaccgattcgag
aacttgcaggacacagccgacctcttccaggagaagctcggtattacatgcacaaagcct
gaacttgagctaattcgccgtcttgcggagctcatcggcacgcgtgctgcccggcttact
gcctgcggtgtttctgccatttgtaagcacaagcactgggatgaggtgcacgtcggtgcc
gacggctccgtcttcacaaagtacccccatttcaagatccgacaagcccaagcgatgaag
gagattatggactggcccgccaagtatggaaagggcaagaacgaccccattgaggtgctc
cctgctgaggatggctctggcgttggtgctgccctcatcgcggcacttaccgttaagcgt
gcgcagcagggtctcttggctggtatccgggaccaggacgctttgttggccatggcgccg
aagaagaagggtaactga

DBGET integrated database retrieval system