KEGG   Parasteatoda tepidariorum (common house spider): 107436391Help
Entry
107436391         CDS       T06106                                 

Definition
(RefSeq) putative leucine-rich repeat-containing protein DDB_G0290503 isoform X1
Organism
ptep  Parasteatoda tepidariorum (common house spider)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_C APH
Motif
Other DBs
NCBI-GeneID: 107436391
NCBI-ProteinID: XP_015903584
LinkDB All DBs
Position
Unknown
AA seq 2155 aa AA seqDB search
MYYRSHSPFSDLRGRSNFSRGLDLGITPRIQRVINSRRPHNDSWTNYYDLVTPRYTSYTI
KKPQRTDYTDFLGPALQSRTLLKPNYVPRSRLERESVVSPLVRERKLIKFREITNDILTG
VRRKISWDLPEEIDSPLINEMKKNEAADNISERIKSRENSLSRRGSPTVMSRRSSDQSID
RMSRLRLKSPRNSTELNLERNDLQSIHIPRKKSLGSSRRIKKHKPSIESIDEKILNSSSI
IKDKMVRNRPHEETSFAQTVESAQSADLPIRRRRRPEITCDNEGQPPDITNHMHRKSVKY
KITDSPNQCVSEQLATKKPSEMPLKSDINEAKNSLTKEVPKKYDKQNEEKHPSDVLTKTS
FKSKNEEKKFNSDSNTTHNKLYKSEKSSEKNELLNIINKDTETVPNSYIKNSTVLNIDRK
RTDKTAGNNLDSKGNDLDNTSAEKIKSSINKPLEKLNSDVIVNKDLNCNDNAMISIPNRV
NQENTKIKNVADLKDTSVKHNVSNEIREDIKILESKQPVSKSDSANKNVSSENESNNISQ
NSKCNLPSANWASKTGFTASDVLDKPKVADSNKQSVECNKKPKTTHFSNDQKQKTNNDAL
KNKKSDDIVIKNKLPEMKCNSNFEKQSSNEKITPKSKEFSPKAMNKTNLDQSSTENNIKS
LRHESNPALLKMKIKNNENTSEIKSSNLNDIRNSSLFTPTDVKSQDILKQKKNISLSQDV
KIMSKDQDEIVVICKLPQPKSKSNEIISSIQSEVNAKATALESSVGTNNTQQPIIPGKTI
QPIDKPDNVETHIKLKEPDLGLEVNVSHTVVLKSKFQNAKTVQAEKNMNHLKAIPDLIQS
TIKISSDSNHNDKIKKNKDSNNNKLSVDINSNEIVRKIMPSEQLKSNDEILPKNSYEIPD
PLPYNNNLISQKKEQNEIILNKEIQTLSTKSKSNSLNSDAKVNNFKCSKLETKCSDLKSN
YLKPLVPISDSNLSKSETKVTKNKNLSSEKTETNDRDLEANEPKVLELKIDKLVPSKSTV
KDKTLECSKPIIKSGDLVTSTLKTVKPMIKSNDSDSNQSKTVESKTSELKFGKLKSMLPK
VSDVETSESKTMKTVGDLESSKLISTESKHSSNSKPKSRDPEPNNLKAIESKLSDSEISK
SKPLGPKASYVKSEKLETVEIKTAGIESSKPKALGDLDSLKLKTVESINELEFSNSKIID
SKTSDMKFNKLKAVVPKFSNVEAIKSKTVDTASDIESSKSKTVDAASNIESSKSKTVDTA
RDIESSKSKTVDTASNIKSSKSKTVDTARDIESSKSKTMDATSNIKSKTVDTASNIESSK
SKTVDTARDIESSKSKTVDATSNIESKTVDAASNIKSSKSKTVDTARDIDSSKSKTIGPK
VDDLEWCKFETIDPKTSDLESNKSKTLDPKNCDLESKKSEIKNSSLESSKLKTLDTKVCC
LELSKLNPKESLELSKPNISSVKSEKPDTTEIKSVGLESRAEGSVPLKIAEKGNENKEVL
NSSDKPKLKLDKRSVCRSKTSENINSTFESKTSEIEEKTARKRYRKSSTVPNVETSEKIV
SKLVPLEKRWKDNSDCSKCDLKTYKDADNNSQLSEPVGLSEEKQVSVQNRNCNSNENKTG
EHKLSFKTKTSEVILKHLPEKILKVVSDVKEKFCNEVLKKEETVKLEHKVTDTDTLKTSN
KTANKTGLQEKPKDTTDLKNTKKTEKSAKIVDVKSPVHKRKKDLPPMSPRPTRYGLVIGH
PVNLYSSSSDSESWDSSSSVSSLYDSPYEDNEKSSLRGFSNGVEKRERLSSTVSNSTIVT
NFSTLSLDESPPKTPKKLNFRKYTIDDFLFLKLLGTGSFGKVLLAELKDHDMFFAVKCLR
KDTVLEDDDVESAMIERRVLALGTQHPYLCKLYCTFQTDSYLFFVMEYLNGGDLMFHIQN
GQFEESRAMFYGAEIVSALKFLHKRGIVYRDIKLDNILFDKTGHVHLVDFGMCKSEMLDP
YAKTSTFCGTPDYIPPEIILGQRYNQSVDWWSFGVLLFEMILGRSPFVGTDEDELFWSIC
NEEPSYPHFISKQAKDILQKLLTKSVSDRLGMPSSPYGEIKEHPFFISIDWNKLEKKEVP
PPFKPTVISASDTRNFDRSFTMNSPSLSPVDSAILQSMDQEQFLGFSYTNPNIVG
NT seq 6468 nt NT seq  +upstreamnt  +downstreamnt
atgtattatagaagccactctccgttctctgacctaagagggcgaagcaattttagtcga
ggtctggatttaggtattacaccgagaattcaacgtgtaattaattccagaagacctcat
aatgatagctggactaattattatgatttggtgacacctcgttatacttcatatactatt
aaaaaaccacaaagaacggattacacagattttttagggcctgctttgcaaagtcgaact
ttgttaaaaccaaattatgtgccacgatctcgcctcgaaagagagagtgtcgtgtctcct
cttgttagagaaagaaaactcattaaatttcgtgaaatcacaaatgatatcttaactgga
gtaagaagaaaaatttcttgggatttgcctgaggaaattgattcacctcttataaatgag
atgaaaaaaaatgaagcggcggataacattagtgagcgtattaaaagtagggaaaatagt
ttatccagacgaggatcacctactgttatgtcaagaagatcttcagatcaaagtatcgat
cgtatgtctcgattacgtcttaaatcccctagaaatagtactgaattaaaccttgaaaga
aacgatttacaatccatacatattcctagaaaaaaatcccttggctcatctcgtcgtatt
aaaaaacataaaccatcaatagaaagtattgacgaaaaaatcttaaatagcagctctatt
ataaaagataaaatggttagaaataggccccacgaagaaacgtcatttgcccaaactgtc
gagagcgctcagtcagcagatttaccgattagacggcggcgacgacctgaaattacatgc
gataatgagggacagccacctgacattaccaaccatatgcatcggaaatcggttaaatat
aaaattactgattcacctaaccaatgtgtttcagagcagcttgcaaccaaaaaaccttct
gagatgcctttgaaaagtgacataaatgaggccaaaaattctctgacaaaagaagtccca
aaaaaatacgataaacaaaatgaagaaaaacacccaagcgatgtattgaccaaaacgtcg
ttcaaatctaaaaatgaggagaaaaaattcaattctgattcaaatactactcataataag
ttatataaatcggaaaaatcaagcgaaaaaaatgagcttttgaatataattaataaagat
acagaaactgttccaaattcctacattaaaaactccactgttctgaatattgacagaaaa
aggacagataaaacagccggaaataatttggattcgaaaggtaacgatttagataatact
agtgccgaaaaaataaaatcaagtattaataaacctctagaaaaattaaattcggacgta
attgtaaataaagatttaaactgcaatgacaatgcaatgatttctattccaaaccgtgtt
aatcaagagaatacaaaaataaaaaacgtagctgatctaaaagatacttcagtgaaacat
aatgttagtaacgaaattcgagaggatattaaaatcttagaatccaaacaaccagtctct
aaatctgattctgcaaataaaaatgttagttctgaaaatgaatctaataacatatcccag
aactctaaatgtaatcttccttctgcaaactgggcatccaaaacaggctttacagcatct
gacgtattagataaaccaaaagttgccgacagtaataaacaatctgtggaatgtaataaa
aagcccaaaacaactcatttttcaaatgaccagaaacaaaaaacaaataatgatgcatta
aagaataaaaaatctgatgatatcgtgatcaagaataaactaccagaaatgaaatgtaat
tccaattttgaaaaacaatcaagtaatgaaaaaataacaccgaaatccaaagaattttct
cctaaagccatgaataaaactaatctcgatcaaagttcgactgagaataacataaaatct
cttcgacatgaatctaatcctgcattacttaaaatgaaaataaaaaataatgagaacaca
agtgaaatcaaaagctcaaatttaaacgatattcgtaattctagtttgtttacaccaaca
gatgttaagtcgcaagatattttaaaacagaaaaaaaatatttctttgagtcaagatgtc
aaaataatgagtaaggatcaagatgaaattgttgtaatttgtaaattgcctcaaccaaaa
tctaaatcaaatgaaatcatttcttctattcaaagcgaagttaatgctaaagcaactgct
ttagaaagttccgtgggtacaaataatacacaacaaccaatcattccaggaaaaactatt
caacctattgataaacctgataacgttgaaacgcacattaagttaaaggaacctgactta
ggtcttgaggttaatgtatctcatactgtagttttaaaatcaaaatttcaaaatgcaaaa
actgtgcaagctgaaaaaaatatgaaccatttaaaagctattcccgatttaatacagagt
accataaaaattagcagtgatagcaaccataacgataaaattaaaaaaaataaagattca
aataataataagttatcggtagacatcaattccaatgaaattgtccgaaaaattatgcca
tctgagcagcttaaaagtaacgatgaaattcttccgaaaaatagttatgaaattcctgat
cctttaccttataacaataatttaatatcccagaaaaaggagcaaaatgaaattatcttg
aataaagaaatacaaactttaagtacgaaatcaaaaagtaatagtttgaactcagacgca
aaggtgaataattttaagtgtagtaaattagaaacaaaatgcagtgatttgaaatctaac
tatttaaaacctctcgtaccaataagcgactcgaatttgagcaaatcagaaactaaagtc
acaaaaaataaaaatttatcatccgaaaaaacagaaacaaatgatagagatttagaagca
aatgaaccaaaagttttagagctaaaaatagataaattggtgcctagcaaatcaacagta
aaagataaaacattggagtgcagtaaaccaataataaaaagcggagatttggttactagt
acattaaagactgtaaagccaatgattaagtcaaatgattcagattcaaatcaatcaaaa
actgtagaatcaaaaaccagtgagttaaaatttggtaaattgaaatctatgctgccaaaa
gtcagtgatgtggaaaccagtgaatcaaaaactatgaaaacagttggtgatcttgaatca
agtaaattaatttctacagagtctaaacactcgagcaattcaaaaccaaaaagcagagac
ccggaaccaaacaatttaaaggctattgagtcaaaattaagtgattcggaaattagtaaa
tcaaaacccttaggaccaaaagccagctatgtaaaatctgaaaaattagaaactgtcgaa
ataaaaactgccggaatagaatccagtaaaccaaaagctctaggagatttagactctctt
aaattaaaaactgtcgaatcaataaatgaattagagtttagtaattctaaaatcattgat
tcaaaaaccagtgacatgaaattcaataaattaaaagctgtagtaccaaaattcagtaat
gtggaagccataaaatcaaaaactgtggatactgctagtgatattgaatcaagcaaatca
aaaactgtagatgctgctagtaatattgaatcaagtaaatcaaaaactgtggatactgct
cgtgatattgaatcaagtaaatcaaaaactgtagatactgctagcaatattaaatcaagt
aaatcaaaaactgtggatactgctcgtgatattgaatcaagtaaatcaaaaactatggat
gctactagtaatattaaatcaaaaactgtggatactgctagtaatattgaatcaagtaaa
tcaaaaactgtggatactgctcgtgatattgaatcaagtaaatcaaaaactgtagatgct
actagtaatattgaatcaaaaactgtagatgctgctagtaatattaaatcaagtaaatca
aagactgtggatactgctcgtgatattgactcaagtaaatcaaaaactattggtccaaag
gttgatgatttggaatggtgtaaatttgaaactatagatccaaaaactagtgatttggaa
tctaataaatcaaaaacattggatcctaaaaattgtgacttagaatctaagaaatcagaa
ataaaaaacagttctttggaatcaagcaaactaaagactcttgatacgaaagtatgttgt
ttagaattgagcaagctaaatcctaaagaatccttagaattgagcaagccaaatatcagc
agtgttaaatctgaaaaaccagatactacagaaataaaatctgttggactagaatccaga
gctgaaggttcagttcccttgaaaattgctgaaaagggaaatgaaaataaagaagttctg
aattccagtgataaaccaaaattaaaacttgataaacgctcagtgtgcagatcaaaaaca
tcggaaaacattaactctacttttgaaagtaaaacttctgaaattgaggaaaaaactgcc
agaaaacgttatagaaaatcatctactgttccaaatgttgaaacttcagaaaaaatcgtt
tctaaactagttccattggaaaagagatggaaagataattctgactgctcaaaatgtgac
ttaaaaacatataaagatgctgataataatagtcagttaagtgaacctgttggcttatcg
gaagaaaaacaggtttcggttcaaaatcgcaattgcaattcaaatgaaaataagacagga
gaacataagctgtcatttaaaactaagacttctgaagttattttgaaacatttaccagaa
aaaattttaaaagtggtttcagatgtcaaagaaaaattttgtaacgaggttttgaagaaa
gaggaaactgtaaaacttgaacataaagtaacggacactgatactcttaaaacctcaaac
aaaactgcaaataaaactggtttgcaagaaaaacctaaggatactaccgatctcaaaaat
actaaaaaaactgaaaaaagtgccaagatagttgatgtgaaatcaccagttcataaacga
aaaaaggatttacctcccatgagtcctcgaccaacccgttatggattggttataggacat
ccagtcaatttatattcctcatcatctgattctgaatcatgggattcaagctcttcagta
tcatcactttatgattcgccatatgaggataatgagaagagttctttacgaggattctcg
aatggggtggagaagcgagaaagactctcttccactgtctcaaattcgacaattgtcaca
aacttttcgacattatctttggatgagagccctccaaagactccaaaaaagcttaatttt
cgaaaatacaccatcgatgattttctctttctgaaactattaggtactggaagcttcgga
aaggtgttactggctgaactgaaagatcatgacatgttttttgccgttaaatgtttgaga
aaagatactgtacttgaagatgatgatgtagaaagtgctatgattgaaagaagagtttta
gcccttggcacacaacatccttatttgtgcaaattatattgtacttttcagactgacagt
tatctcttctttgttatggaatatttaaatggaggtgaccttatgtttcatattcaaaat
ggtcagtttgaagaatctagagctatgttctatggagctgaaattgtcagtgcattgaaa
tttcttcacaagagaggaatagtttacagagatatcaaattagacaatattttatttgac
aagaccggccatgttcatcttgttgattttggcatgtgcaaatctgaaatgcttgatcca
tatgctaaaacttctactttttgtggaacccctgattatattccaccagagattattctg
ggacaaagatacaatcaatctgttgattggtggtcttttggtgtactgttatttgaaatg
attcttggtagatctccatttgttggtacagatgaagatgaacttttctggagtatctgc
aatgaggaaccatcttatccacattttatatcaaagcaagcaaaagatattctacagaag
cttttgacaaaatcagtcagtgatagattgggtatgccctctagtccgtatggggaaatt
aaagaacatcctttctttatttccattgattggaataaacttgagaagaaagaagtacca
cccccttttaaaccaactgttatttctgctagtgatacaagaaactttgatcgtagtttt
acaatgaattctccatctctaagtcctgttgattctgcaattcttcaatcaatggatcag
gagcaattccttggatttagttacacaaatcctaatatagttggataa

DBGET integrated database retrieval system