KEGG   Parasteatoda tepidariorum (common house spider): 107436430
Entry
107436430         CDS       T06106                                 

Definition
(RefSeq) ras association domain-containing protein 1-like
  KO
K09850  Ras association domain-containing protein 1
Organism
ptep  Parasteatoda tepidariorum (common house spider)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Ras_bdg_2
Other DBs
NCBI-GeneID: 107436430
NCBI-ProteinID: XP_015903645
LinkDB
Position
Unknown
AA seq 403 aa
MFSDYKSIRRAYTPPVTPIRGRKPRPISGSDGDVRIKLNFSPSGILQNFAFPHPFRRRNK
SKDRYSDGDVAGTLRPRELIELASFGVVELEPAERGIGHQFQISSLKNPTWCDCCGDFIW
GLYNSTDCLRCLNCRYTCHQRCQHLVTLDCKGSSGDTQTTNFSEIIDNTLKSDVRERDRL
SPLFFEHLDGEELRHRIERYNALHHSSEMVLQEDGETLHGFIRVHMNLTRPINVIAGTRP
PSIYDILKEEDDCGRKTLTSFYLPRDTVKALHITSEYSAREVINALLKKFKVADNPHKFA
LYERTYSNGFNKAKLRRIQDHEIPLLLALYACDEDKHFVLQENETEDIIWEQFAIPELNN
FLKILDLEEEEYINQVKLKYKMLHEKIQDVMNTIPQSDISETS
NT seq 1212 nt   +upstreamnt  +downstreamnt
atgttctctgattacaaaagcatacggcgagcttatactcctccagtaactccaattaga
ggaagaaaacctagacctatatctggcagtgatggggatgttcgtatcaaactcaatttt
tctccctctggaattctccaaaattttgcatttcctcatccttttcgcagaagaaacaaa
tccaaggataggtattcagatggtgatgttgcaggtacattgagacccagagaattaatt
gagttagcaagctttggtgttgtggagttggaaccagctgaaagaggaattggacaccaa
tttcaaatttccagcttaaagaatccaacttggtgtgactgttgtggagattttatctgg
ggcctatacaactcaacagattgtcttagatgccttaattgtcgttatacctgtcaccag
aggtgccaacatcttgtgacgcttgactgtaaaggatcatctggtgatacacaaacaacc
aatttcagtgaaataattgacaacactttaaaaagtgatgttagagagagggacaggttg
tcacctttattttttgaacatcttgatggggaagagttacgtcatagaattgaacgctat
aatgcattgcaccatagttctgaaatggttttgcaagaagatggtgaaacgctacacggg
tttattcgtgtccacatgaacctaacaaggccaatcaatgtaattgctgggacacgtcca
ccttccatctatgatattctaaaagaagaagatgattgtggtagaaaaacattaacttct
ttttatttacctcgagatactgttaaagccttgcacataaccagtgaatactctgcccga
gaagtcatcaatgctttgctgaaaaaatttaaagtagctgacaatcctcacaaatttgcc
ttatatgaaaggacctattccaatggttttaataaagcaaaactgcgaagaattcaggat
catgagataccattgttgctagcactgtatgcctgtgatgaagataagcattttgtatta
caagaaaatgaaacagaggatattatttgggagcagtttgcaatccctgagcttaataat
tttctgaaaattctggacttagaagaggaagagtacattaatcaagtaaaactcaagtac
aaaatgctgcatgaaaaaattcaggacgtcatgaatactattcctcaatcagatatatct
gaaactagctag

DBGET integrated database retrieval system