KEGG   Parasteatoda tepidariorum (common house spider): 107442907
Entry
107442907         CDS       T06106                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1 isoform X1
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
ptep  Parasteatoda tepidariorum (common house spider)
Pathway
ptep04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:ptep00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    107442907
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 107442907
NCBI-ProteinID: XP_015912078
LinkDB
Position
Unknown
AA seq 170 aa
MSGKRRTACPKTGDEKEAGDTNSPDTSLPPPLSSIPQSPTCRKIFFDENFKVTPFPEASE
EVIEQQKQKWNFDFQTETPLPGRYLWLRTEGSSGYYKNGKGAPLDNPPRRGEGQRRASKR
SHQSEEGVEDSRTKKKDSESGISCDTALNESQESGESLRFSDTPLGIDLT
NT seq 513 nt   +upstreamnt  +downstreamnt
atgagtggtaagagacgaactgcgtgccctaagactggtgacgaaaaggaagcgggagat
acaaattctccggatacttcattgccacctcctctcagttccattcctcagtcaccaact
tgccgaaaaatattctttgacgaaaatttcaaagtcacaccttttcccgaggcatcagaa
gaagtaatagaacaacagaaacagaaatggaactttgattttcaaacagaaacacccttg
ccggggcgttacctctggttgagaactgaaggaagcagtggttattacaaaaatggaaag
ggagcgcccttagataatcctccccggcgaggtgaaggccaaaggagagcttctaaacga
tcacatcagagtgaagaaggggtggaagatagtaggacgaagaagaaagattcagaatct
gggatttcatgtgatacagcgctcaacgaatcccaggaatccggggaatcccttcgattc
agcgacacccctctcggcattgacttgacgtaa

DBGET integrated database retrieval system