KEGG   Parasteatoda tepidariorum (common house spider): 107443706
Entry
107443706         CDS       T06106                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
ptep  Parasteatoda tepidariorum (common house spider)
Pathway
ptep04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:ptep00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    107443706
SSDB
Motif
Pfam: CDI SRP_SPB
Other DBs
NCBI-GeneID: 107443706
NCBI-ProteinID: XP_021001413
LinkDB
Position
Unknown
AA seq 174 aa
MCTAQVLLLNRDAMRRNFGSDVNRRVCRKLFETSDPNPVGPAVFLKKMQEEIRKRDTERW
NFDFLTETPLAGRYQWEPVFANKSSSSKKQSTAPESNREERVQQAPVEPIVEEIHKAGPT
TQKKKKTGAGASSQHKITDFMTTKKRRNPEECSSSKLKVRRVGRNSLTTTTRLR
NT seq 525 nt   +upstreamnt  +downstreamnt
atgtgcactgcgcaagtgctcttactaaatcgcgacgcgatgcgacgtaattttggtagt
gatgtaaacagacgagtgtgtcgaaagttgtttgaaactagcgatccaaatccggtaggt
ccggcagtgttcttgaaaaagatgcaagaagaaattagaaaaagagacacggagcgctgg
aactttgatttcctgacggaaacaccgctggcaggaaggtatcaatgggaacccgtgttt
gccaacaaatcatccagcagtaaaaagcaatcaacagcaccggaatcgaaccgggaggaa
agagtccaacaagctcctgtggaaccgattgttgaagagattcataaagcaggacctact
actcaaaagaagaaaaaaactggcgcaggcgcctcttctcaacataaaatcacagatttc
atgacaacgaaaaagcgaagaaatccagaagagtgttcctcttccaaactgaaagttcgc
cgagtgggtcgtaatagtctcacaactacgacgaggctgaggtag

DBGET integrated database retrieval system