KEGG   Parasteatoda tepidariorum (common house spider): 107446423
Entry
107446423         CDS       T06106                                 

Definition
(RefSeq) bcl-2-related ovarian killer protein homolog A
  KO
K20017  Bcl-2 family protein
Organism
ptep  Parasteatoda tepidariorum (common house spider)
SSDB
Motif
Pfam: Bcl-2 LLC1 Haem_oxygenas_2
Other DBs
NCBI-GeneID: 107446423
NCBI-ProteinID: XP_015916539
LinkDB
Position
Unknown
AA seq 214 aa
MNLSLSGYAADNAARRQKGSSVTNQLIGWRSSQQLVVEQAKSLCSKYLRFKLKNCKKLGL
QRLKWPPAELVFELRELGMEMERNHPELYQSVTENVGLYSLPSEYAVQNLLSTLATELFR
DRHVTWGRIVALYVLAGALAVDCVKLGRPEYVLGLVQAVGNSIEKDLANWIIQQGGWGTL
TTRFKKNSTLQSQRFLITSIVLISIFAVFYYFLP
NT seq 645 nt   +upstreamnt  +downstreamnt
atgaatctctctttgtcaggatatgcagcagataatgccgccaggcgtcaaaaaggaagc
agcgttacgaatcaactcatcggatggagaagctcacagcaattagtagttgagcaagca
aagagcttgtgtagcaaatatctcaggtttaagttgaaaaattgtaaaaaacttggactt
caacgactgaaatggcctccggcagaacttgttttcgaacttcgagagttaggaatggaa
atggaacgaaatcacccagaactttatcaaagcgttaccgaaaatgttggactctattct
ttaccatcagaatatgctgtgcaaaatttattaagtacactggcaacagaactttttcgt
gatcgtcatgtcacttggggacgaattgttgcactctatgtgttggctggagctctagca
gttgattgcgttaaacttggacggccagaatatgttcttggattagttcaagctgttgga
aatagtatcgaaaaagatttggcaaattggatcatccaacaaggaggatggggaactctt
acaacacgatttaagaaaaattctactctgcaatctcaaagattcctaattacttcgatt
gttttgataagcatatttgccgttttttattactttttaccatga

DBGET integrated database retrieval system