KEGG   Parasteatoda tepidariorum (common house spider): 107455365
Entry
107455365         CDS       T06106                                 

Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
ptep  Parasteatoda tepidariorum (common house spider)
Pathway
ptep00230  Purine metabolism
ptep01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptep00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107455365
Enzymes [BR:ptep01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     107455365
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA DUF1053
Other DBs
NCBI-GeneID: 107455365
NCBI-ProteinID: XP_021004448
LinkDB
Position
Unknown
AA seq 1120 aa
MKNNAKAHNTNKKDMKPIDEEMNMKETRKQNGTGDEPSFLSRGETELKIDRSGLQRYLPQ
CLQFAFAEKSAESLYREYYRIEKRRNTKTLLLVLALVDIVLLATYAVALPFRDASQLIGQ
ASFLAGALLILFIIFIVVRCYASVLPSKLWDCIPFIAWFIQLGHLVCDMWLFSVPRMPGD
SVAWAILYTYMVYLLLPLRLSVCLILSIVMAFVHLLLVGVLPKPIDFTENQLGANVLLFI
CANLLGILSYFFLERRQRRAFLETRQSLEAKLVLEEESQEQERLLLSVLPQHVAAEIRED
LGAVVTGQFKKIYMSRHENVSILFADIVGFTAISSTCTAPELVKILNELFARFDKLSDKY
HQLRIKILGDCYYCISGAPEERPDHAVLCVHMGLSMVEAIKSVREKTNSGVDMRVGVHTG
AILAGVMGQRQWQFDVYSRDVVLANKMESGGMAGRVHISEKTLGFLNGEFEVSPGDGMSR
EEALRSAGLETYFIVKILKPYPMGTLDEKAEINGRTGKEELDQEEILAALIEDVEEEEGE
LSKLTGDSDKNFEEDYKARLHEELLGRDTKRVVTVDGALETTSECKSHIRQQANPLTLFF
KEPKLETEFRKIKDTVSVVSISGLPLILVFCTAAYFLVMSGSSFALICLPLGSLLLIIIT
IICIVPAGLKAGPPGLVRMCNKIIEKPGLRMGVIFIMVMVWCVVHVLSTDYDNSWSWPSN
VMSTYVNPLQNISSNRSNSTLPPPIVTSTSQTWLTHNFPQYLTYFTVLELIGLTVMTHLS
HLVKLFLTLVIAVIQGFININLVQESLDYYDERTYGMNDYDLSHSITLTVIVVIVAICLI
IINRQLEVTSRRLFLWQKDVEEQREKVADMRVKNEALVYNILPPHVAKHFLGQRKKDEEL
YSKSYEAVGVLFAAMPNFSDFYTEDSVNNQGLECLRFLNEVISDYDALLEQPRFKDIIKI
KTIGSSYMAASGLTDDNYNPNASIKEKWAHLAALTEFALTLKETLTNINKESFNNFLLRM
GINQGPITAGVIGARKPHYDMWGNTVNVASRMESTGKAGFIQVVEETARILEEFDYVFEQ
RGMVAVKGKGNLMTYYLLGRKSDLNKSPVKPVVQKTQSSS
NT seq 3363 nt   +upstreamnt  +downstreamnt
atgaagaacaacgcgaaggctcataacaccaacaaaaaggacatgaagcctattgatgaa
gaaatgaacatgaaggaaacaaggaagcagaacggtaccggcgatgagccatccttcctc
agcagaggtgaaaccgagctaaaaatcgacagatccggccttcaacggtatcttcctcaa
tgcctacagttcgcctttgctgaaaagagcgcagaaagtttgtacagagagtactacagg
atagaaaaaaggcggaacaccaaaaccttactactagtccttgcattggtcgacatagtc
ctgcttgctacctatgccgtggcccttcctttccgggatgctagtcaacttattggacaa
gcatcatttcttgctggagccctcctcattctatttattatattcatagttgttcgctgt
tatgcatctgtgttaccttctaagttatgggactgtatcccttttatagcctggtttatc
caactgggacatctagtctgtgatatgtggctgttcagtgttccgaggatgcctggagac
tctgtggcttgggcaatcctctacacttacatggtttacctgctgctgcctctacggtta
agtgtttgtctcatcctcagcatagtgatggcctttgttcacttgcttctagtcggcgtc
ctgcctaaacccatcgatttcacagagaatcagcttggagcaaatgtattgctattcatt
tgtgcaaatcttcttgggatcttatcttatttctttttggaaaggcggcaacgacgtgct
tttcttgaaacgcgacaaagtttagaagccaaattagtactagaagaagagtcacaagaa
caggaacgacttctactatcggttttaccacagcacgttgctgccgaaatacgggaggac
ttaggagcagtagttacgggccagttcaagaaaatatatatgagcagacatgagaatgtg
agcattctttttgccgacatcgttggtttcacagcaatatcttccacttgtacagctccc
gaattagtgaaaattctaaacgaactctttgctagatttgacaaactctctgacaaatat
catcagctacgcataaaaattcttggtgactgctattactgcattagtggtgcccctgag
gaaaggccagaccatgcagtcctctgtgttcatatgggtttgagcatggttgaagccatc
aagtctgttcgagagaaaacgaattcaggtgtggatatgagagtaggagtgcatactggt
gcaatcttagcaggagtgatgggacaaaggcaatggcaattcgatgtctacagcagagat
gttgtacttgccaataaaatggaaagcggtggaatggcgggacgagtgcatatctcagaa
aaaacacttggattcttaaacggagaattcgaagtatcacctggtgatggaatgtctcgt
gaagaagctctcagatctgctggattggagacatatttcatcgtcaaaattctgaagccg
tatccaatgggcacacttgatgaaaaagctgaaataaatggaagaacaggaaaagaagaa
ctagaccaagaggaaattttagcggctttaatagaagatgttgaagaagaggagggcgag
ttatccaaactgacgggtgacagtgacaaaaatttcgaagaggactacaaggcacgattg
cacgaagagctccttggaagagacacgaaaagagtggtgactgttgatggtgccttagag
acgacatcggaatgcaaaagtcacataagacagcaagccaatcccttaactttgttcttc
aaggagccgaaattagaaactgaattccgaaagatcaaagataccgtcagtgtagtatca
atttctgggctacctctaattttggttttctgtactgctgcttattttctagtcatgtcg
ggaagttcttttgctctcatatgccttcctcttggttctttgctactcataataatcacc
attatatgtatagtcccagctggacttaaggctggccctcctggattagtgcgcatgtgc
aataaaatcatagaaaaaccaggattgcgaatgggcgtaatatttatcatggtcatggtt
tggtgcgtcgttcatgttctatcaactgattatgacaacagttggtcatggccttccaat
gtgatgtctacttacgtaaatcctcttcaaaacatcagcagcaatcgaagcaactcaact
ctacctccacccattgtaaccagcaccagtcagacatggttgacccacaacttcccacag
tacctcacgtacttcacagtgctggaactaataggtctaactgtaatgacccatctgtcc
catctggtcaagctctttttgactttggtgatcgctgtaatccaaggcttcatcaacatc
aatcttgtgcaagagtccttggattattacgatgaaagaacttatggcatgaatgattat
gatctaagtcactccattacgctgactgtgattgttgtcatcgtagcaatatgtttaatc
atcatcaaccgacagcttgaagtgacatccagaaggcttttcttatggcaaaaagatgtg
gaagaacagagagaaaaagtagccgatatgagggttaagaatgaagcattggtctacaat
attttaccacctcatgttgccaaacatttcttaggtcaacgaaagaaggacgaggaattg
tacagcaaaagctacgaagcagtgggtgttctttttgctgctatgccaaatttctccgat
ttctatactgaagattctgtcaataatcaagggttggaatgcttaaggttcctaaacgaa
gttatttctgattatgatgcgcttttagagcaacccagattcaaagatatcattaaaatc
aagactatcggctcttcatacatggcagcaagtggtttaacagatgataattataatccc
aatgcatctataaaagaaaaatgggcccacttagctgctcttacagaatttgcactcaca
ctgaaagaaactctgactaacatcaacaaagaaagtttcaataatttcttactaagaatg
ggaattaatcaaggaccaatcacagctggtgtaattggagctaggaaacctcactatgat
atgtggggaaatactgttaacgtcgcctcaagaatggagtctactggaaaagcaggattt
atacaggttgtggaagaaacagcacggatcctggaagaatttgattacgtttttgaacaa
agagggatggttgccgtaaagggcaaaggaaatctcatgacgtattaccttttgggaagg
aagtctgaccttaataagtccccagtcaaaccagtagtccaaaaaacacaatcctcaagc
taa

DBGET integrated database retrieval system