KEGG   Parasteatoda tepidariorum (common house spider): 107455826
Entry
107455826         CDS       T06106                                 

Definition
(RefSeq) bcl-2-related ovarian killer protein homolog A
  KO
K20017  Bcl-2 family protein
Organism
ptep  Parasteatoda tepidariorum (common house spider)
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 107455826
NCBI-ProteinID: XP_015929024
UniProt: A0A2L2YD58
LinkDB
Position
Unknown
AA seq 274 aa
MAISPTANGSANRPMTLAPPSMGRPRKYSLPVIYPRPSLSVYAAAENTKESMSRRRKFSQ
VGQVVGHRLSTTIGWRSPISQHDVVNQAKSLCGRYLRTKLRSCSAVHKKLGLQRLKSVSN
LACGSNTAEIANELRLLANELENSHPKLFQSVASNLGLHNMPSEAVVHSVFASVAEEIFR
NGVTWGRIVALFAMTGALAMDCVKAGHPEYVLGLVQRMGIFVERDLAPWICQQGGWATLL
TRFKKDSTTNYAKEVICFFFVAVFILIAWWIFVY
NT seq 825 nt   +upstreamnt  +downstreamnt
atggccatatcgccaacagcgaatggctctgccaacaggccaatgacattagctcctccg
tctatgggaaggcctagaaaatatagtttaccagttatctatccgagaccatctttgtca
gtttatgctgcagctgaaaacacgaaagaatctatgtctcgtcggaggaaatttagtcaa
gtcggacaagtcgttggtcacagactgtccacaaccattggatggcggagtcccatatca
caacatgatgtcgtgaatcaagccaaaagtctttgtggtcgatatcttcgcaccaaactt
cgttcctgttcggccgtccacaagaaattaggtctacagaggctgaaaagcgtcagtaac
cttgcttgtggatccaacacggcagaaatagctaatgagcttcgtttgctggcgaacgag
ctcgaaaactctcatccaaagctattccaaagcgttgcttctaatctcggtctacataac
atgccatcagaagctgtcgtccacagcgttttcgcatcagttgctgaagaaatctttcga
aatggtgtgacgtggggaaggatcgtagcactttttgctatgacaggagcacttgccatg
gactgtgtaaaggcaggtcatccggaatatgttttaggattggtgcaacggatgggaatc
ttcgtcgaaagagatttagcaccatggatatgccagcaaggtggatgggcgacattactg
acaagattcaagaaggacagtacaaccaactatgctaaagaggttatttgcttctttttc
gtagcagtcttcattctcattgcctggtggatttttgtttactaa

DBGET integrated database retrieval system