KEGG   Paraburkholderia terrae: C2L65_00055Help
Entry
C2L65_00055       CDS       T05318                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
pter  Paraburkholderia terrae
Pathway
pter00010  Glycolysis / Gluconeogenesis
pter00620  Pyruvate metabolism
pter01100  Metabolic pathways
pter01110  Biosynthesis of secondary metabolites
pter01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pter00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C2L65_00055
   00620 Pyruvate metabolism
    C2L65_00055
Enzymes [BR:pter01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     C2L65_00055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: AUT58158
UniProt: A0A2I8EFK4
LinkDB All DBs
Position
1:complement(11180..12700)
Genome map
AA seq 506 aa AA seqDB search
MNHAEMKFLTTEFPFKKQYANFIGGEWVKPVGGEYFDNISPITGEPFTSIPRSREADIEL
ALDAAHRAKAAWGKTSTTDRANILNKIADRMEANLQRLAVAETIDNGKPLRETMAADIPL
AIDHFRYFAGTVRAQEGGISEIDHDTVAYHFHEPLGVVGQIIPWNFPILMATWKLAPALA
AGNCVVLKPAEQTPASILVLLELIQDLLPAGVLNVVNGFGLEAGKPLASNKRIAKIAFTG
ETTTGRLIMQYASQNIIPVTLELGGKSPNIFFADVLDKDDSFFDKALEGFAMFALNQGEV
CTCPSRVLVEESIYDRFMERAVKRVAAIQQGHPLDSKTMIGAQASREQLEKILSYIDLGK
QEGAQCLIGGEQNKLDGELSKGYYVKPTVFRGHNKMRIFQEEIFGPVVSVTTFKNEEEAL
EIANDTLYGLGAGVWTRDGTRAYRFGREIQAGRVWTNCYHAYPAHAAFGGYKQSGIGREN
HKMMLDHYQQTKNLLVSYSDKPLGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaatcacgcagagatgaagtttctgacaaccgagttcccgttcaagaagcagtacgcg
aatttcatcggcggtgaatgggtcaagccggttggcggcgagtacttcgacaacatctcg
ccgattacgggcgagccgttcacgtcgataccgcgttcgcgcgaagccgacatcgaactc
gccctcgacgccgcgcatcgcgccaaggccgcctggggcaagacatcgaccaccgaccgc
gccaacatcctcaacaagatcgccgaccgcatggaggcgaacctgcagcgcctcgccgtc
gcggagacgatcgacaacggcaagccgctacgcgaaacgatggcggccgacattcccctc
gcaatcgatcacttccgctatttcgcgggcaccgtgcgcgcgcaggaaggcggcatttcg
gagatcgatcacgacacggtcgcatatcactttcatgagcctctcggcgtagtcggtcag
atcattccgtggaacttcccgatcctgatggccacgtggaagcttgcgcccgcgctcgcg
gcaggcaattgcgtcgtgctgaagcccgctgaacagacgcccgcttcgatcctcgtgctg
ctcgaactgattcaggatctgctgccggcgggcgtgctgaacgtcgtcaatggattcggt
ctcgaagcgggcaagccgctcgcgtcgaacaagcgcatcgcgaagatcgccttcacgggg
gaaacgacgacgggccgcctgatcatgcagtacgcgagccagaacatcattcccgtgacg
ctggagctcggcggcaagagcccgaacatcttcttcgccgacgtgctcgacaaggacgac
agcttcttcgacaaggcactcgaaggcttcgcgatgttcgcgctgaatcagggcgaagtc
tgcacctgcccgtcgcgcgtgctggtcgaagaatcgatttacgaccgcttcatggagcgc
gcggtgaagcgcgtcgccgccatccagcagggacacccgctcgactcgaagacgatgatc
ggcgcgcaggcttcgcgagagcaactggaaaagatcctgtcgtacatcgatctcggcaag
caggaaggcgcgcaatgcctgatcggcggcgagcagaacaagctcgacggcgaactctcg
aagggctattacgtgaagccgaccgtgttccgcggtcacaacaagatgcgcatcttccag
gaagaaatcttcggccccgtcgtttccgtcacgacgttcaagaacgaagaagaagcattg
gagatcgccaatgacacgctgtatggcctcggcgccggcgtctggacgcgcgacggcacg
cgcgcctatcgcttcggtcgcgagattcaggcgggccgcgtgtggacgaattgctaccac
gcgtacccggcgcatgcggcgttcggcggctacaagcagtcgggcatcggacgcgagaat
cacaagatgatgctcgatcactaccagcaaacgaagaatctgctggtcagctatagcgac
aaaccgttgggcttcttctga

DBGET integrated database retrieval system