KEGG   Paraburkholderia terrae: C2L65_02740Help
Entry
C2L65_02740       CDS       T05318                                 

Definition
(GenBank) superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pter  Paraburkholderia terrae
Brite
Enzymes [BR:pter01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     C2L65_02740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AUT58634
UniProt: A0A2I8EIF6
LinkDB All DBs
Position
1:609661..610239
Genome map
AA seq 192 aa AA seqDB search
MEHTLPPLPFAKNALAPHMSEETLEFHYGKHHQTYVTNLNNLIKGTEFENLSLEEIVKKS
SGGIFNNSAQIWNHTFFWNSLSPQGGGAPKGKVAEAINAKWGSFEKFKEEFTKTAVGTFG
SGWAWLVKKADGSLDLVSTSNAATPLTTDAKALLTIDVWEHAYYIDYRNARPKFVEAFWN
IVNWDFAEKNFA
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggaacatacgctcccgccgctgccgttcgcgaagaacgcgctcgctccgcacatgtcg
gaagagacgctcgagtttcactacggcaagcaccatcagacctatgtgaccaacctgaac
aatctgatcaagggcactgagttcgagaacctgtcgctggaagagatcgtcaagaagtcg
tcgggcggtatcttcaacaactccgcgcaaatctggaatcacacgttcttctggaacagc
ctgtcgccgcaaggtggtggcgcgccgaagggcaaggtcgccgaagcgatcaacgcgaag
tggggttccttcgagaaattcaaggaagaattcacgaagacggcagttggcacgttcggc
tcgggctgggcatggctcgtgaagaaggcagacggttcgctggatctggtgtcgacgagc
aacgccgccacgccgctgaccacggacgcaaaggcgctcctcacgatcgacgtgtgggaa
cacgcgtactacatcgactaccgcaatgcgcgtccgaagttcgttgaagcattctggaac
atcgtgaactgggacttcgcggaaaagaatttcgcgtaa

DBGET integrated database retrieval system