KEGG   Paraburkholderia terrae: C2L65_11370Help
Entry
C2L65_11370       CDS       T05318                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pter  Paraburkholderia terrae
Pathway
pter00620  Pyruvate metabolism
pter00680  Methane metabolism
pter01100  Metabolic pathways
pter01120  Microbial metabolism in diverse environments
pter01200  Carbon metabolism
Module
pter_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pter00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    C2L65_11370
  09102 Energy metabolism
   00680 Methane metabolism
    C2L65_11370
Enzymes [BR:pter01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     C2L65_11370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AUT60135
UniProt: A0A2I8EKM5
LinkDB All DBs
Position
1:2573129..2576224
Genome map
AA seq 1031 aa AA seqDB search
MTSSGSARPARRTTASPDAVNTASAAPAASAVKAAKAVKATQALDSGKTGKSTKTKAPAN
GVSKRIKSDGAGKQEAARASKEAKNGAAAQVKDNARTREDKDQPLFEDIRYLGRLLGDVV
REQEGDAVFDVVETIRQTAVRFRREDDSVAAQALDKKLRALSPEQTVSVVRAFSYFSHLA
NIAEDRHRNRRHRIHDLAGSTSQPGTIAHALDRLVEANAAATPVLQQFFNDALIVPVLTA
HPTEVQRKSILDAQHDIARLLAERDQPLTARERLQNESLLRARVTSLWQTRMLRDSRLTV
ADEIENALSFYRATFLEEIPALYADIEEALVEHGLDARLPPFFQMGSWIGGDRDGNPNVT
GETLENAITRQAAVIFEHYLEQVHKLGAELSVSNLLAGASDELKALAEASPDHSPHRTDE
PYRRALIGIYTRLGASARVRLGEGVVPLRSAGPGAPKIRATPYDDSSEFVRDLHVLIDSL
TEHHGASLATPRLSPLTRAAEVFGFHLASIDLRQSSDIHEAVIAELLRRAGVESDYAALS
EGDKLRVLLAELSQPRLLRSPYVEYSDLVKSELGVLEQARVTREKFGARAVRNYIISHTE
TVSDLVEVMLLQKEAGLLQGALGNPVDPARAGLMVIPLFETIPDLRNASHIMRDLLALPG
IDAIIENQGNEQEVMLGYSDSNKDGGFLTSNWELYRAELALVSLFNERGITLRLFHGRGG
TVGRGGGPTYQAILSQPPGTVDGQIRLTEQGEVIASKFGNPDIGRRNLETVVAATLEASL
LPHGNAPSQLPDFEEVMQTLSDAAMASYRALVYETPGFTEYFFSSTPIAEIAELNIGSRP
ASRKLQDPKQRKIEDLRAIPWGFSWGQCRLLLTGWYGFGSAVAGWLEAAGSNVERERRVN
LLRKMHKAWPFFANLLSNMDMVLAKTDLAVASRYAALVADKKLRKHVFERIVAEWERTSN
VLSEITGKKERLADNPLLARSIKNRFPYLDPLNHLQVELLKRHRAGDDNVRVRRGIHLTI
NGIAAGLRNTG
NT seq 3096 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtcttccggatcggcgcgccctgcccgccgcactactgcctcgcccgatgccgtc
aataccgcatcggccgctcccgccgcttccgctgtcaaggccgccaaggccgtgaaagcc
acgcaagctctcgactccggcaaaaccggcaaatccacgaagaccaaggcgcccgccaac
ggcgtctcgaaacgaattaaatccgacggcgccggcaagcaggaagccgcgcgcgcgtcg
aaagaagcgaagaacggcgccgcggcgcaggtgaaggacaatgcccgcacgcgcgaagac
aaggaccagccgctcttcgaagacatccgctatctcggacgcctgctcggcgacgtggtg
cgcgagcaggaaggcgacgcggtgttcgacgtcgtcgaaacgattcgtcagacggctgtg
cgctttcgccgcgaggacgacagcgtcgccgcacaggcgctcgacaagaaactgcgcgcg
ctgtccccagagcagacggtgagcgtcgtgcgcgcgttcagctacttctcgcaccttgcg
aacatcgctgaagaccgtcatcgcaatcgccggcaccggattcacgatctggccggctcg
acgtcgcagccgggcacgattgcgcatgcgctcgaccggctcgtcgaagcgaacgccgcc
gcgacgcccgtgctgcagcagttcttcaacgacgcgctgatcgtcccagtgctgacggcg
cacccgacggaagtgcagcgcaagagcattctcgacgcgcagcacgacatcgcgcgcctg
ctcgccgaacgcgaccagccgctgacggcacgcgagcgactgcagaacgaatcgctactg
cgcgcgcgcgtgacgtcgctgtggcagacgcgcatgctgcgcgactcgcgcctgacggtc
gccgatgaaatcgagaacgcgctgtcgttttaccgcgcgacgttcctcgaagaaatcccc
gcgctctacgccgacatcgaagaagcgctcgtcgagcacggcctcgacgcgcgcctgccg
cccttcttccagatgggcagctggattggcggcgaccgcgacggcaacccgaacgtcacg
ggcgaaacgctcgaaaacgcgatcacgcgtcaggccgcggtgatcttcgagcactatctg
gaacaggtacacaagctcggcgcggaactgtcggtgtcgaacctgctggcgggcgcgagc
gacgaactgaaggcgctcgcggaagcctcgcccgatcactctccgcatcgcacggacgag
ccgtaccggcgcgcgctgatcggcatttacacgcggcttggcgccagtgcgcgcgtgagg
ctcggcgaaggcgtcgtgccgctgcgcagcgccggccccggcgcgccgaagattcgcgcg
acgccctatgacgattcgtccgagttcgtgcgcgatctgcatgtgctgatcgattcgctt
accgaacatcacggcgcgtcgctggcaacgccgcgtctgtcgccgctgacgcgcgccgcc
gaagtgttcggcttccacctcgcgagcatcgatctgcgccagagctccgacattcacgaa
gcggtgatcgcggagctgctgcggcgcgcgggtgtcgaaagcgactacgcggcactttcg
gaaggcgacaagctgcgcgtgctgctcgcggaactttcgcagccgcgcctgctgcgctcg
ccgtatgtcgagtactcggatctggtgaagagcgaactcggcgtgctggaacaggcgcgc
gtgacgcgcgagaagttcggcgcgcgcgcggtgcgcaactacatcatttcgcacacagag
acggtgagcgatctggtcgaagtgatgctgctgcaaaaggaagcgggcctgctgcaaggc
gcgctcggcaacccggtcgatccggcgcgcgcgggcctgatggtgatcccgctcttcgag
acgattcccgacttgcgcaacgcgtcgcacatcatgcgcgacctgctggcgctgccgggc
atcgatgccatcatcgagaaccagggcaacgagcaggaagtgatgctcggctattcggac
agcaacaaggacggtggcttcctgacgtcgaactgggagttgtaccgcgcggaactggcg
ctggtgtcgctgttcaatgagcgcggcatcacgctgcggctgttccatggacgcggcggt
acggttggacgcggcggcggcccgacctatcaggcgattctttcgcagccgccgggcacg
gtcgatgggcagatacgcctgacggaacagggcgaggtgattgccagcaagttcggcaac
ccggacatcggccgacgcaatctggagaccgtcgttgccgcgacgctcgaagcgtcgttg
ctgccgcatggcaatgcgccttcgcaactgcccgacttcgaggaagtgatgcagacgctg
tcggatgcggcgatggcgtcgtaccgtgcgctcgtctatgagacgccgggcttcactgag
tacttcttctcgtcgacgccgattgcggagatcgctgagttgaacatcggcagccggccg
gcgtcgcgcaagctgcaggacccgaagcaacgcaagatcgaggacctgcgggcgattccg
tggggtttctcatggggacaatgccggttgctgctgacgggctggtatgggtttggtagt
gcggtagctggatggctcgaggccgcgggctcgaatgtcgagcgtgaacgtcgtgtgaat
ctgctgcgcaagatgcataaggcgtggccgtttttcgcgaacctgctgtcgaatatggat
atggtgctggctaagaccgatctcgcggtggcgtcgcggtatgccgcgcttgtggctgac
aagaagctgcgtaagcatgtgttcgagcggattgtcgcggagtgggagcgcacgtccaat
gtgctttctgaaattaccgggaagaaagaacgtctcgcggataatcctttgctggcgcgg
tctattaagaatcggtttccgtatctcgatccgttgaatcacttgcaggtggagctgctt
aagcgccatcgcgccggggatgataatgtccgcgtgcggcgtgggattcatttgactatc
aatgggattgcggctgggttgaggaatacgggctga

DBGET integrated database retrieval system