KEGG   Paraburkholderia terrae: C2L65_14465Help
Entry
C2L65_14465       CDS       T05318                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
pter  Paraburkholderia terrae
Pathway
pter00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pter01100  Metabolic pathways
pter01110  Biosynthesis of secondary metabolites
pter01130  Biosynthesis of antibiotics
pter01230  Biosynthesis of amino acids
Module
pter_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:pter00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    C2L65_14465
Enzymes [BR:pter01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     C2L65_14465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 Cytidylate_kin2 AAA APS_kinase AAA_16 TsaE FtsK_gamma AAA_22 Cytidylate_kin
Motif
Other DBs
NCBI-ProteinID: AUT60688
UniProt: A0A2I8EMN2
LinkDB All DBs
Position
1:complement(3263118..3263669)
Genome map
AA seq 183 aa AA seqDB search
MQPRDAHANVFFVGLMGAGKTTVGRAVARRLDRPFFDSDHEIEARTGARIPVIFELEGEA
GFREREAQVIADLTGRESIVLATGGGAVLRPENRDALRAHGIVVYLRANPHDLWLRTRRD
KNRPLLQTEDPKGRLEALYEVRDPLYRECAHFVIETGRPSVNGLVNMVLMQLEMAGVARP
AAS
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaccgcgggacgcacacgccaacgttttttttgtagggctcatgggggcaggcaag
accaccgtgggccgggccgtggcgcgccggctggatcgcccgttcttcgactccgatcat
gaaatcgaggcgcgcacgggcgcgcgcatcccggtgatcttcgaactcgaaggcgaagcg
ggctttcgcgaacgcgaggcgcaagtgatcgccgacctcaccgggcgcgagagcatcgtg
ctcgccacgggcggcggcgcggttttgcgcccggaaaaccgcgacgcgttgcgcgcgcac
ggcatcgtcgtctatctgcgcgccaatccgcacgatctctggctgcgcacgcgccgcgac
aagaaccggccgcttctgcagaccgaggacccgaaagggcgcctcgaagcgctctacgaa
gtgcgtgatccgctctatcgcgagtgcgcccattttgtgatcgaaacgggccgtccgtcc
gtcaacgggctcgtcaacatggtgctgatgcagctcgagatggcgggcgtcgccaggcct
gctgcgtcataa

DBGET integrated database retrieval system