KEGG   Paraburkholderia terrae: C2L65_19810Help
Entry
C2L65_19810       CDS       T05318                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pter  Paraburkholderia terrae
Brite
KEGG Orthology (KO) [BR:pter00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C2L65_19810
Enzymes [BR:pter01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     C2L65_19810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored Thi4 FAD_binding_3 HI0933_like K_oxygenase DAO Glutaredoxin FMO-like AlaDh_PNT_C NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AUT61936
UniProt: A0A2I8EQT2
LinkDB All DBs
Position
2:805802..807394
Genome map
AA seq 530 aa AA seqDB search
MLDANLKTQLKAYLEKVSRPIEIVASVDDSAKSQEMLALLNDIATLSERVSVIERRGDDE
RKPSFSIGEPGKAAGIRFAGIPMGHEFTSLVLALLQTGGHPIKLDDAVIQQIRELDGDFA
FETYFSLSCQNCPEVVQALNIMALINPRIRHVAIDGALFQNEVESRQIMAVPTMFLNGEV
FGQGRSGVKEILAKLDTNAGARAAKELEKKPVFDVLIVGGGPAGAAAAIYAARKGIATGV
VAERFGGQVLDTLAIENFVSVQETEGPKFATALEQHVKSYEVDVMDVQRAEALIPGKINE
VRLASGAVLKAKTIVLATGARWREINVPGEREYRNHGVAYCPHCDGPLFKGKRVAVVGGG
NSGVEAAIDLAGLVSHVTLIEFGATLRADEVLQRKLRSLANVTVITQAQTTEITGDGKKV
NGLTYTDRASNESKHVELEGVFVQIGLVPNTEWLKGTVELSKHGEIVVDAKGATSVPGVF
AAGDVTTVPFKQIVIAVGEGAKASLAAFDHLIRSSVEDLEDAQAAELVEA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgcgaatctgaagacccaactcaaagcctacctcgagaaagtcagtcgtcct
atcgagatcgtcgcctccgtcgacgacagcgcgaagtcgcaggaaatgctcgcgctgctg
aacgacatcgccacgctgtcggagcgcgtcagcgtgatcgagcgccgcggcgacgacgag
cgtaagccctcgttttcgatcggtgagccgggcaaggcggcgggcatccgcttcgccggc
attccgatgggtcatgagttcacgtcgctggtgctggcgctgctgcaaacgggcggccac
cccatcaagctcgacgacgccgtgatccagcagatccgcgaactcgacggcgacttcgcg
ttcgagacgtatttctcgctgtcgtgccagaactgcccggaagtcgtgcaggcgctcaac
atcatggcgctgatcaacccgcgcatccgtcacgtggcgatcgacggcgcgctgttccag
aacgaagtcgagtcgcgccagatcatggccgtgccgacgatgttcctgaacggcgaagtg
ttcggccagggccgcagcggcgtgaaggaaatcctcgcgaagctcgacaccaatgcaggc
gcgcgtgccgcgaaggaactggagaagaagccggtgttcgacgtgctgatcgtcggcggc
ggtcctgctggcgcggcggctgcgatctacgcggcgcgcaagggcattgcgacgggcgtc
gtcgcggaacgcttcggcggccaggtgctcgacacgctggcgatcgaaaacttcgtgtcc
gtgcaggaaacggaagggccgaagttcgccacggcgcttgagcagcacgtgaagagctat
gaagtcgacgtgatggacgtacagcgcgccgaagcgctgatccccggcaagatcaacgaa
gtgcgcctcgcgagcggcgcggtgctgaaggcgaagacgatcgtgctggcgacgggcgcg
cgctggcgcgagatcaacgtgccgggcgagcgcgagtaccgcaatcatggcgtcgcgtac
tgcccgcactgcgatggtccgctattcaagggcaagcgcgtcgcggtggtcggtggtggt
aactcgggtgtcgaagcggcgatcgatctggcgggtctcgttagccacgtgacgttgatc
gaattcggcgcaacgctgcgcgctgacgaagtgctgcaacgcaagctgcgcagcctcgcg
aacgtgacggtcatcacccaggctcagacgacggaaatcacgggcgacggcaagaaggtc
aacggtctgacctacacggaccgtgcatcgaacgagtcgaagcatgtcgagctcgaaggt
gtgttcgtacagatcggtctggtgccgaacaccgaatggctgaagggcacagtcgagctg
tcgaagcacggcgagatcgtcgtcgacgcgaagggcgcgacgtcggtgccgggtgtgttc
gccgccggcgacgtgacgacggtgccgttcaagcagatcgtgatcgccgtgggcgagggc
gcgaaggcatcgctggccgcgttcgatcatctgatccgttcgagcgtcgaagatctggaa
gacgcgcaggcagcggaactggttgaggcctga

DBGET integrated database retrieval system