KEGG   Paraburkholderia terrae: C2L65_26515Help
Entry
C2L65_26515       CDS       T05318                                 

Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
pter  Paraburkholderia terrae
Pathway
pter00250  Alanine, aspartate and glutamate metabolism
pter00410  beta-Alanine metabolism
pter00640  Propanoate metabolism
pter00650  Butanoate metabolism
pter01100  Metabolic pathways
pter01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pter00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    C2L65_26515
   00650 Butanoate metabolism
    C2L65_26515
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    C2L65_26515
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C2L65_26515
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pter01007]
    C2L65_26515
Enzymes [BR:pter01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     C2L65_26515
Amino acid related enzymes [BR:pter01007]
 Aminotransferase (transaminase)
  Class III
   C2L65_26515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AUT63875
UniProt: A0A2I8EW84
LinkDB All DBs
Position
2:2299905..2301188
Genome map
AA seq 427 aa AA seqDB search
MKNAELKSRKDAATPRGVGVMCDFYAARAENAELWDVEGRRYIDFAAGIAVCNTGHRHPK
IVEAVRAQLDNFTHTAYQIVPYASYVELAEKINQRAPGDYPKKTAFFTTGAEAVENAIKI
ARAATGRPGVIAFTGGFHGRTMMGMALTGKVAPYKLNFGPFPADVFHAPFPNPLHGVTTA
DSLKAIEFLFKADIDPKRVAAIIFEPVQGEGGFYPAPAEFVRALRKLCNEHGILLIADEV
QTGFARTGKLFAMHHYDVVPDLMTMAKSLAGGMPLSGVVGRADVMDAAAPGGLGGTYAGN
PLAVASALAVLDIIDEEKLCERAVLLGDKLKARLTALQAEVPQIADVRGPGGMVAVEFCK
PGTSDADADFTKRVQTRALERGLLLLVCGVYSNVVRFLFPLTVQDAVFDEALSILEEVLK
ETVGVTV
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaatgctgaactgaagagccgcaaggacgccgccaccccgcgcggcgtgggcgtg
atgtgcgatttctacgctgcgcgcgccgagaatgcggagctgtgggacgtcgagggccgc
cgctacatcgatttcgcggcgggcattgcggtgtgcaacacgggccaccgtcatccgaag
atcgtcgaggctgtgcgcgcacaactggacaacttcacgcacacggcttatcagatcgtg
ccgtacgcgtcgtacgttgagctagccgagaagatcaaccagcgcgcgccgggcgactat
ccgaagaagacggcgttcttcacgacgggcgccgaagccgtcgaaaacgcgatcaagatc
gcgcgcgccgcgacgggccgtccgggcgtgatcgcgttcacgggcggcttccatggccgc
acgatgatgggcatggcgctgacgggcaaagtcgcgccgtacaagctgaacttcggcccg
ttcccggctgacgtgttccacgcgccgttcccgaatccgctgcacggcgtgacgacggcg
gattcgctgaaggcgatcgaattcctgttcaaggccgacatcgatccgaagcgcgttgcg
gcgatcattttcgagccggtgcaaggcgaaggcggtttctatccggcgcctgccgagttc
gtgcgcgcgctgcgcaagctgtgcaacgagcacggcattctgctgattgccgatgaagtg
caaacggggtttgcgcgtacgggcaagctgtttgcgatgcatcactacgacgtcgtgcct
gatctgatgacgatggccaagagcctggcgggtgggatgccgctgtcgggcgtcgtcggt
cgtgccgatgtgatggatgccgccgcgcccggcgggctgggcggcacgtatgcgggtaat
ccgttggcggtggcttcggcgcttgccgtgctcgatatcatcgatgaagagaagctctgc
gagcgggctgttttgcttggcgacaagttgaaggcgcggttgaccgcgttgcaggcggaa
gtgccgcagattgctgatgtgcggggtcctggcggtatggttgccgttgagttctgcaag
cccggcacgtccgacgcggatgcggactttaccaagcgggtgcagacgcgggctcttgag
cgtggtttgttgctgctcgtttgtggggtttattcgaacgttgttcggttcttgttcccg
ctgactgtgcaggatgctgtttttgatgaggcgctttctattcttgaggaagtgctcaag
gaaactgtgggcgtgactgtctga

DBGET integrated database retrieval system