KEGG   Paraburkholderia terrae: C2L65_27420
Entry
C2L65_27420       CDS       T05318                                 

Gene name
aepX
Definition
(GenBank) phosphoenolpyruvate mutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
pter  Paraburkholderia terrae
Pathway
pter00440  Phosphonate and phosphinate metabolism
pter00998  Biosynthesis of various secondary metabolites - part 2
pter01100  Metabolic pathways
pter01110  Biosynthesis of secondary metabolites
pter01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pter00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    C2L65_27420 (aepX)
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    C2L65_27420 (aepX)
Enzymes [BR:pter01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     C2L65_27420 (aepX)
SSDB
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD NTP_transferase
Other DBs
NCBI-ProteinID: AUT63272
UniProt: A0A2I8EV55
LinkDB
Position
2:complement(2484911..2486620)
AA seq 569 aa
MNAREPSFVSTLSRSARLRQMLTSNELEFLMEAHNGISARIAREAGFKGIWGSGLAISAQ
YGVRDNNEASWTQVVDTLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCI
EDKVFPKTNSFIKGEAQPLADIDEFCGKIKAGKDSQTDEHFSIVARVEALIAGWGMDEAL
KRAEAYRQAGADAILIHSKLSRPDEILEFAREWAGRGPLVIVPTKYYSTPTEVFRKAGIS
TVIWANHQIRAATSAMQAVVKEIYESQTLVNVEDRIATVNEIFRLQDADEYSVAEERYLS
SSRVAGSAVVLAASRGKGLEAVTTDRPKVMLPIAGKPLLRWLVDAFKKQGVNDITVVGGY
RADAIDTAGIKLVVNERHEQTGELASLACAVDGLQNDTVISYGDLLFRSYIVRDLVDSEA
LFSVVVDSTTVAEAGATNQSVRDFAWCSAADDRGLFGNKVLLRRVANNEADVKGEVPNGR
WIGLLNVRGAGRERLQAVMNTLRARPDFDSLDMPALLNALIEAGEEIEVQYVHGHWRGVN
DLEDFRRAGDFAHEATPLAKSEAAGGAAQ
NT seq 1710 nt   +upstreamnt  +downstreamnt
atgaacgcacgcgaaccctctttcgtttctactctgtcgcgcagcgcacgcctgcgccag
atgctcaccagcaacgagctcgaattcctgatggaagcgcacaacggcatctccgcacgc
attgcgcgcgaagccggcttcaagggcatctggggctcgggcctcgcgatctccgcgcaa
tatggtgtgcgcgacaacaacgaagcaagctggacgcaagttgtcgatacgctcgaattc
atggccgacgcaagcgacctgcccattctgctcgacggcgacaccggctacggcaacttc
aacaacgtgcgccgcctcgtgcgcaagctggagcagcgcggtattgcgggcgtttgcatc
gaagacaaggtgttcccgaagaccaacagcttcatcaagggcgaagcgcagccgctcgcc
gatatcgacgagttctgcggcaagatcaaggcgggcaaggactcgcagacggacgagcat
ttctcgatcgtcgcgcgcgtcgaagcgttgatcgcgggctggggcatggacgaagcgttg
aagcgcgccgaggcgtatcgccaggcgggcgcggacgcgatcctgattcacagcaagctg
tcgcgtcccgatgagatcctcgagttcgcgcgcgaatgggcaggccgcggtccgctcgtg
atcgtgccgaccaagtactacagcacgccgacggaagtgttccgcaaggcgggcatcagt
acggtgatctgggcgaaccatcagattcgtgcggcgacgtccgcgatgcaggctgtcgtc
aaggaaatctacgagagccagacgctcgtcaacgtcgaagaccgcattgcgaccgtcaac
gaaatcttccgtttgcaggatgccgacgagtactcggtagcggaagagcgctatctgtcg
tcgtcgcgcgtggccggttcggctgtcgtgcttgccgcgagccgcggcaagggtctcgaa
gccgtgacgacggatcgtccgaaggtcatgctgccgatcgcgggcaagccgctgctgcgc
tggctcgtcgacgcattcaagaagcagggcgtcaacgacatcacggtcgtgggcggctat
cgcgccgacgcgatcgacacggcgggcatcaagctagtcgtcaacgagcgccacgaacag
acgggcgaactggcgtcgctcgcgtgcgccgtcgacggcttgcagaacgacacggtgatc
tcgtacggcgacctgctgttccgcagctacatcgtgcgcgatctggtggacagcgaagcg
ctgttcagcgtggtcgtcgattcgacgacagttgccgaagcgggcgcgacgaaccagagc
gtgcgcgatttcgcgtggtgctcggccgccgacgatcgcggcctgttcggcaacaaggtg
ctgctgcgccgcgtggcgaacaacgaagccgacgtgaagggcgaagtgccgaatggccgc
tggatcggtctgctgaacgtgcgcggcgcgggccgcgagcgtctgcaggcggtgatgaac
acgctgcgcgcgcgccccgatttcgattcgctcgacatgcctgcactgttgaatgcgctg
atcgaagccggtgaagaaatcgaagtgcaatacgtgcatggccactggcgcggtgtgaac
gacctcgaagacttccgtcgcgcgggcgacttcgcgcacgaagcaacgccgctcgcgaag
agcgaggcagcgggaggcgcggcgcaatga

DBGET integrated database retrieval system