KEGG   Paraburkholderia terrae: C2L65_27420Help
Entry
C2L65_27420       CDS       T05318                                 

Gene name
aepX
Definition
(GenBank) phosphoenolpyruvate mutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
pter  Paraburkholderia terrae
Pathway
pter00440  Phosphonate and phosphinate metabolism
pter01100  Metabolic pathways
pter01120  Microbial metabolism in diverse environments
pter01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pter00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    C2L65_27420 (aepX)
Enzymes [BR:pter01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     C2L65_27420 (aepX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD NTP_transferase
Motif
Other DBs
NCBI-ProteinID: AUT63272
UniProt: A0A2I8EV55
LinkDB All DBs
Position
2:complement(2484911..2486620)
Genome map
AA seq 569 aa AA seqDB search
MNAREPSFVSTLSRSARLRQMLTSNELEFLMEAHNGISARIAREAGFKGIWGSGLAISAQ
YGVRDNNEASWTQVVDTLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCI
EDKVFPKTNSFIKGEAQPLADIDEFCGKIKAGKDSQTDEHFSIVARVEALIAGWGMDEAL
KRAEAYRQAGADAILIHSKLSRPDEILEFAREWAGRGPLVIVPTKYYSTPTEVFRKAGIS
TVIWANHQIRAATSAMQAVVKEIYESQTLVNVEDRIATVNEIFRLQDADEYSVAEERYLS
SSRVAGSAVVLAASRGKGLEAVTTDRPKVMLPIAGKPLLRWLVDAFKKQGVNDITVVGGY
RADAIDTAGIKLVVNERHEQTGELASLACAVDGLQNDTVISYGDLLFRSYIVRDLVDSEA
LFSVVVDSTTVAEAGATNQSVRDFAWCSAADDRGLFGNKVLLRRVANNEADVKGEVPNGR
WIGLLNVRGAGRERLQAVMNTLRARPDFDSLDMPALLNALIEAGEEIEVQYVHGHWRGVN
DLEDFRRAGDFAHEATPLAKSEAAGGAAQ
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacgcgaaccctctttcgtttctactctgtcgcgcagcgcacgcctgcgccag
atgctcaccagcaacgagctcgaattcctgatggaagcgcacaacggcatctccgcacgc
attgcgcgcgaagccggcttcaagggcatctggggctcgggcctcgcgatctccgcgcaa
tatggtgtgcgcgacaacaacgaagcaagctggacgcaagttgtcgatacgctcgaattc
atggccgacgcaagcgacctgcccattctgctcgacggcgacaccggctacggcaacttc
aacaacgtgcgccgcctcgtgcgcaagctggagcagcgcggtattgcgggcgtttgcatc
gaagacaaggtgttcccgaagaccaacagcttcatcaagggcgaagcgcagccgctcgcc
gatatcgacgagttctgcggcaagatcaaggcgggcaaggactcgcagacggacgagcat
ttctcgatcgtcgcgcgcgtcgaagcgttgatcgcgggctggggcatggacgaagcgttg
aagcgcgccgaggcgtatcgccaggcgggcgcggacgcgatcctgattcacagcaagctg
tcgcgtcccgatgagatcctcgagttcgcgcgcgaatgggcaggccgcggtccgctcgtg
atcgtgccgaccaagtactacagcacgccgacggaagtgttccgcaaggcgggcatcagt
acggtgatctgggcgaaccatcagattcgtgcggcgacgtccgcgatgcaggctgtcgtc
aaggaaatctacgagagccagacgctcgtcaacgtcgaagaccgcattgcgaccgtcaac
gaaatcttccgtttgcaggatgccgacgagtactcggtagcggaagagcgctatctgtcg
tcgtcgcgcgtggccggttcggctgtcgtgcttgccgcgagccgcggcaagggtctcgaa
gccgtgacgacggatcgtccgaaggtcatgctgccgatcgcgggcaagccgctgctgcgc
tggctcgtcgacgcattcaagaagcagggcgtcaacgacatcacggtcgtgggcggctat
cgcgccgacgcgatcgacacggcgggcatcaagctagtcgtcaacgagcgccacgaacag
acgggcgaactggcgtcgctcgcgtgcgccgtcgacggcttgcagaacgacacggtgatc
tcgtacggcgacctgctgttccgcagctacatcgtgcgcgatctggtggacagcgaagcg
ctgttcagcgtggtcgtcgattcgacgacagttgccgaagcgggcgcgacgaaccagagc
gtgcgcgatttcgcgtggtgctcggccgccgacgatcgcggcctgttcggcaacaaggtg
ctgctgcgccgcgtggcgaacaacgaagccgacgtgaagggcgaagtgccgaatggccgc
tggatcggtctgctgaacgtgcgcggcgcgggccgcgagcgtctgcaggcggtgatgaac
acgctgcgcgcgcgccccgatttcgattcgctcgacatgcctgcactgttgaatgcgctg
atcgaagccggtgaagaaatcgaagtgcaatacgtgcatggccactggcgcggtgtgaac
gacctcgaagacttccgtcgcgcgggcgacttcgcgcacgaagcaacgccgctcgcgaag
agcgaggcagcgggaggcgcggcgcaatga

DBGET integrated database retrieval system