KEGG   Paraburkholderia terrae: C2L65_32925Help
Entry
C2L65_32925       CDS       T05318                                 

Definition
(GenBank) pyridoxal phosphate-dependent aminotransferase
  KO
K00812  aspartate aminotransferase [EC:2.6.1.1]
Organism
pter  Paraburkholderia terrae
Pathway
pter00220  Arginine biosynthesis
pter00250  Alanine, aspartate and glutamate metabolism
pter00270  Cysteine and methionine metabolism
pter00330  Arginine and proline metabolism
pter00350  Tyrosine metabolism
pter00360  Phenylalanine metabolism
pter00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pter00401  Novobiocin biosynthesis
pter01100  Metabolic pathways
pter01110  Biosynthesis of secondary metabolites
pter01130  Biosynthesis of antibiotics
pter01210  2-Oxocarboxylic acid metabolism
pter01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pter00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    C2L65_32925
   00270 Cysteine and methionine metabolism
    C2L65_32925
   00220 Arginine biosynthesis
    C2L65_32925
   00330 Arginine and proline metabolism
    C2L65_32925
   00350 Tyrosine metabolism
    C2L65_32925
   00360 Phenylalanine metabolism
    C2L65_32925
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    C2L65_32925
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    C2L65_32925
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pter01007]
    C2L65_32925
Enzymes [BR:pter01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     C2L65_32925
Amino acid related enzymes [BR:pter01007]
 Aminotransferase (transaminase)
  Class I
   C2L65_32925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_MocR Aminotran_5 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AUT64473
UniProt: A0A2I8EXX8
LinkDB All DBs
Position
3:complement(689039..690247)
Genome map
AA seq 402 aa AA seqDB search
MSASRIAARVQRIKPSPSSAAADRAAELRRQGKHIVNLVVGEPDFDTPAHIRKAAFEAME
RGETRYTPTAGTPALRAAIAAKLQRENGLTYDPKHIIVTCGAKHAIFNALAVTVEAGDEV
LIPAPYWVSYPDMTLACDGVPVIVPCTEETGFKLTPAILEKAITARTRWLIINSPTNPTG
ATYTAQELRALADVLLRHPQVLVMMDDIYEHIRFDGGPSQHLLAIEPELASRTLVVNGVS
KTYAMTGWRIGYVAGPADLIAALDTLQSQSTSNACTISQAAALAALTGDQSFVAESVNTY
RQRRDHALEALNAIPGISCKTPGGAFYLYVNCGGMIGRTTPQGKRLEGDADVVLYLLEQA
GVALVAGSAYGVSPFFRMSIATSIDIIDEGCRKIAAAVAALD
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgcatcgcgcatcgccgcccgcgtccagcggatcaagccatcacccagcagcgca
gccgccgatcgcgccgcagaattgcggcggcagggaaaacacatcgtcaacctcgtggtc
ggcgagcccgatttcgacacgcccgcgcatatccggaaggctgcattcgaagcgatggag
cgcggtgaaacgcgttatacgccgacagccggcacgcccgcgctgcgcgcggcgattgcc
gcgaagctgcagcgcgagaacggcctcacgtacgacccgaagcacatcatcgtgacgtgt
ggcgcgaagcacgcgatcttcaacgcgctcgccgtcacggtcgaagccggcgacgaagtg
ctgattcccgcgccctactgggtctcctatcctgacatgacgcttgcgtgcgacggcgtg
cccgtcatcgtgccctgtaccgaggaaaccggcttcaagctcacgcccgccatcctcgaa
aaagcgatcaccgcgcgcacccgctggctgatcatcaattccccgaccaatccgaccggc
gcgacctatacggcgcaggaactgcgcgcgctcgccgatgtgctgctgcgtcacccgcag
gtgctggtgatgatggacgacatctacgagcacatccgtttcgacggcgggccctcgcag
catctgctcgccatcgagcccgaactcgcgtcgcgcacgctggtggtcaacggcgtatcc
aagacctatgcgatgacgggctggcgcatcggctacgtggccggtcccgccgacctgatc
gcggcactggacaccttgcagtcgcaatcgaccagcaacgcctgcacgatcagccaggcg
gcggcgctcgccgcgctgacgggcgaccagagtttcgtcgccgaatccgtcaacacctac
cggcagcgccgcgatcacgcgctcgaagcgctcaacgcgattcccggcatcagttgcaag
acgccgggtggcgcgttctatctgtacgtcaactgtggcggcatgatcggacgcacgacg
ccgcaaggcaaacgcctcgaaggcgacgccgacgtggtcctgtatctgctcgaacaggca
ggcgtcgcgctggtcgccggatcggcctatggcgtgtcgccgttcttccgcatgtcgatt
gcgacgagcatcgacatcatcgacgaaggctgccggaagatcgcagccgccgtcgccgca
ctcgactga

DBGET integrated database retrieval system