KEGG   Paraburkholderia terrae: C2L65_34225Help
Entry
C2L65_34225       CDS       T05318                                 

Gene name
rbcL
Definition
(GenBank) ribulose-bisphosphate carboxylase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
pter  Paraburkholderia terrae
Pathway
pter00630  Glyoxylate and dicarboxylate metabolism
pter01100  Metabolic pathways
pter01120  Microbial metabolism in diverse environments
pter01200  Carbon metabolism
Module
pter_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:pter00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    C2L65_34225 (rbcL)
Enzymes [BR:pter01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     C2L65_34225 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AUT64697
UniProt: A0A2I8EYK7
LinkDB All DBs
Position
3:979120..980613
Genome map
AA seq 497 aa AA seqDB search
MNDFSKEAVKPAGSESTQQRSRYSAGVLKYREMGYWQPDYTPKDTDIIALFRITPQPGVE
PEEAAAAVAGESSTATWTVVWTDRLTACDMYRAKAFRVDPVPNASESEPQYFAFIAYDLD
LFEEGSVANLTASIIGNVFGFKPLKALRLEDMRIPVAYLKTFQGPPTGIVVERERLDKYG
RPLLGATVKPKLGLSGKNYGRVVYEGLKGGLDFLKDDENINSQPFMHWRDRYLFAMEAVA
RAQAETGELKGHYLNVTAGTMEDMYERAEFAKELGSCIVMIDLVIGWTAITSMGRWARKN
DMILHLHRAGHGTYTRQRNHGISFRVIAKWLRMAGVDHAHAGTAVGKLDGDPLSVQGYYN
VLRESHNPVDLTRGLYFDQPWAGLRKVMPVASGGIHAGQMHQLLDLFGDDAILQFGGGTI
GHPSGIQAGATANRVALETMVKARNEGRDIANEGPDLLDAAARHCTPLKQALDTWGDITF
NYTPTDTPDFAVTPSVA
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatttcagcaaggaagccgtgaagcccgcaggcagcgaaagcacccaacaacgc
tcgcgctattcggcgggtgtcctcaaatatcgcgagatgggctactggcagcccgactac
acgccaaaagacaccgacatcatcgcgctgttccgcatcacgccgcagccgggcgtcgag
ccggaagaagccgccgccgccgtggcgggtgaatcgtcgacggccacctggaccgtcgtc
tggaccgaccgcctgaccgcgtgcgacatgtaccgcgcaaaagcgtttcgcgtcgacccc
gtgcccaacgccagcgagagcgagccgcagtacttcgcgttcatcgcctatgacctcgat
ctgttcgaggaaggatcggtcgcgaacctgactgcctcgatcatcggcaatgtgttcggc
ttcaagcccctgaaagcgctgcggctcgaagacatgcgcattcctgtcgcgtatctgaag
acctttcagggcccgccgacaggcatcgtcgtcgaacgcgaacggctcgacaaatacggc
cgtccgctgctcggcgcgaccgtcaagccgaagctcgggctgtcgggtaagaactacgga
cgcgtcgtgtacgaaggcctcaagggtggcctcgactttctgaaggatgacgaaaacatc
aactcgcagcccttcatgcactggcgcgaccgctatctgttcgcgatggaagcggtggcc
cgcgcgcaagccgagacgggcgaactgaagggccactacctgaacgtgacggcgggcacg
atggaggacatgtacgagcgcgccgaattcgcaaaggaactcggctcgtgcatcgtcatg
atcgacctggtgatcggctggacggccattacgtcgatgggacgctgggcgcgcaagaac
gacatgatcctgcatctgcatcgcgccgggcatggcacgtacacgcggcagcgcaatcac
ggcatttcgtttcgcgtgatcgcgaagtggctgcgcatggcgggcgtcgatcatgcgcat
gcgggcacggccgttggcaagctcgatggcgatccgctctcggtgcagggttactacaac
gtgctgcgcgaatcgcacaaccccgtcgatctcacgcgcggtctctatttcgatcagccg
tgggcgggcttgcgcaaggtgatgcccgtcgcgtcgggtggcattcacgcgggccagatg
catcagttgctcgatctgttcggcgacgacgcgatcctgcagttcggtggcggcacgatc
ggccatccgtccggcattcaggcgggcgcgacggcgaaccgcgtcgcgctcgaaacgatg
gtcaaggcgcgcaacgaaggccgtgacatcgccaacgaaggccccgatctgctcgatgcg
gccgcgcgtcattgcacgccgctcaagcaggcgctcgatacatggggcgacatcacgttc
aactacacgccgaccgatacacccgatttcgccgtcacgccgagcgtggcctga

DBGET integrated database retrieval system