KEGG   Paraburkholderia terrae: C2L65_38790Help
Entry
C2L65_38790       CDS       T05318                                 

Definition
(GenBank) Rieske (2Fe-2S) protein
  KO
K16319  anthranilate 1,2-dioxygenase large subunit [EC:1.14.12.1]
Organism
pter  Paraburkholderia terrae
Pathway
pter00627  Aminobenzoate degradation
pter01100  Metabolic pathways
pter01120  Microbial metabolism in diverse environments
Module
pter_M00637  Anthranilate degradation, anthranilate => catechol
Brite
KEGG Orthology (KO) [BR:pter00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    C2L65_38790
Enzymes [BR:pter01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.1  anthranilate 1,2-dioxygenase (deaminating, decarboxylating)
     C2L65_38790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rieske Ring_hydroxyl_A Aromatic_hydrox
Motif
Other DBs
NCBI-ProteinID: AUT65481
UniProt: A0A2I8F1T4
LinkDB All DBs
Position
3:complement(2028201..2029472)
Genome map
AA seq 423 aa AA seqDB search
MEMVETPVSFRNTQDTDMVQFPRDDGSRVPYKVFSSQAVYEREQERIFRGPTWNFVALEA
EIPNPGDFKSTFVGDTPVVVTRTEDGSLSAWVNRCAHRGASVCRKARGNATSHTCVYHQW
SFDNSGNLLGVPFRRGQKGMTGMPPDFDPKQHSLRKLRVDSYRGLVFASFSDAVAPLPDY
LGAEMRPWIDRIFHKPIEYLGCTRQYSKSNWKLYLENVKDPYHASMLHLFHTTFNIFRVG
MKARSIPDATHGLHSIITVTKTGEDTSAAYKQQQIRSFDEGFALEDDSILGLVSEYEEDT
TNHIQPIFPQLVIQQIHNTLVARQLLAKGPNNFELIFHFFGYADDTPELRALRIKQANLV
GPAGYISMEDTEATELVQRGTVRDADATSVIEMSRSNPDQQDTVITESLIRRFWVGYQKL
MGY
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggaaatggtcgagacgcctgtcagcttcagaaacacgcaggacacggacatggtgcag
ttcccgcgcgacgacggctcgcgcgtgccctacaaggtgttcagctcgcaagcggtgtac
gagcgcgagcaggagcgtatctttcgcggcccgacgtggaatttcgttgcgctcgaagcg
gagattccgaacccgggcgatttcaagagcacgtttgtcggcgatacgcccgtggtcgtc
acgcgcaccgaggatggttcgctgtcggcatgggtcaaccgctgcgcgcatcgaggcgca
tccgtgtgccgcaaggcgcgcggcaacgcgacgtcgcacacgtgcgtatatcaccagtgg
agcttcgacaacagcggcaatcttctgggcgtgccgttccgccgcggacagaagggcatg
acgggcatgccgcccgacttcgaccccaagcagcacagcctgcgcaagctgcgcgtggac
agctatcgcggcctcgtcttcgcgagtttcagcgacgcagtcgcaccgctgcccgactat
ctcggcgcggaaatgcggccctggatcgatcgcatctttcacaagccgatcgagtatctc
ggctgcacacggcaatactcgaagtccaactggaagctgtatctcgagaacgtgaaggac
ccgtatcacgcgagcatgctgcatctgttccatacgaccttcaacattttccgtgtcggc
atgaaggcgcgatcgattcccgatgcgacgcacggcctgcacagcatcattacggtgacg
aagacgggcgaggacacatcggcggcctacaagcagcaacagatccgctcgttcgatgaa
ggcttcgcgctggaagacgattcgatcctcgggctcgtttccgaatatgaggaagacacc
accaaccatatccagccgatctttcctcaactggtgatccagcagatccacaacacgctg
gtcgcgcgccagctgctggcaaaaggtccgaacaacttcgagctgatcttccatttcttc
ggctatgccgacgacacgccggaacttcgcgcgcttcgcatcaagcaggcgaacctcgtc
ggaccagcgggctatatctcgatggaagacacggaagcgaccgaactcgtgcagcgaggc
acggtgcgcgacgcggacgcgacgtcggtgatcgagatgtcgcgcagcaatccggaccag
caggacacggtgatcacggaaagcctgattcgacggttctgggtcggatatcagaagctg
atgggctattga

DBGET integrated database retrieval system