KEGG   Paraburkholderia terrae: C2L65_40500Help
Entry
C2L65_40500       CDS       T05318                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
pter  Paraburkholderia terrae
Pathway
pter00020  Citrate cycle (TCA cycle)
pter00190  Oxidative phosphorylation
pter00650  Butanoate metabolism
pter01100  Metabolic pathways
pter01110  Biosynthesis of secondary metabolites
pter01120  Microbial metabolism in diverse environments
pter01130  Biosynthesis of antibiotics
pter01200  Carbon metabolism
Module
pter_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pter_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pter_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pter00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C2L65_40500 (sdhB)
   00650 Butanoate metabolism
    C2L65_40500 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    C2L65_40500 (sdhB)
Enzymes [BR:pter01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     C2L65_40500 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     C2L65_40500 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_9 Fer4_7 Fer4_18 Fer4_4 Fer4 Fer2
Motif
Other DBs
NCBI-ProteinID: AUT65777
UniProt: A0A2I8F1K8
LinkDB All DBs
Position
3:complement(2402288..2402992)
Genome map
AA seq 234 aa AA seqDB search
MAKRTFEIYRYDPDKDAAPRMQTYEIEIDSHERMLLDALVKLKALDETLSFRRSCREGVC
GSDAMNINGKNGLACLTNLNDLPQKIVLRPLPGLPVIRDMIVDMTQFFNQYHSIKPYLIN
DTPPPEKERLQSPEERDELDGLYECILCASCSTSCPSFWWNPDKFVGPAGLLQAYRFIAD
SRDQATGERLDNLEDPYRLFRCHTIMNCVDVCPKGLNPTKAIGKIKELMVRRAV
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggccaagcgtacattcgaaatctaccgctacgacccggacaaggacgccgcgccgcgc
atgcagacgtacgagatcgagatcgactcgcacgagcgcatgctgctcgacgcgctggtg
aaactgaaggcactggacgaaacgctgtcgttccgccgctcgtgccgcgagggcgtgtgc
ggctcggacgcgatgaacatcaacggcaagaacggtcttgcctgcctgacgaacctgaac
gacctgccgcagaagatcgtgctgcgtccgctgccggggctgcccgtgattcgcgacatg
attgtcgacatgacgcagttcttcaaccagtatcactcgatcaagccgtacctgatcaac
gacacgccgccgccggagaaggagcgtctgcagtcgccggaagaacgcgacgaactggac
ggcctgtacgagtgcatcctgtgcgcgagctgctcgacgtcgtgcccgagcttctggtgg
aatccggacaagttcgtcggcccggcggggctgctgcaagcctaccgtttcatcgcggat
agccgcgaccaggcgacgggcgagcggctggacaacctggaagatccgtaccgtctgttc
cgttgccatacgatcatgaactgcgtcgacgtgtgcccgaaggggctcaacccgacgaag
gcgatcggcaagatcaaggaattgatggtccggcgtgcggtctga

DBGET integrated database retrieval system