KEGG   Paraburkholderia terrae: C2L65_40505Help
Entry
C2L65_40505       CDS       T05318                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
pter  Paraburkholderia terrae
Pathway
pter00020  Citrate cycle (TCA cycle)
pter00190  Oxidative phosphorylation
pter00650  Butanoate metabolism
pter01100  Metabolic pathways
pter01110  Biosynthesis of secondary metabolites
pter01120  Microbial metabolism in diverse environments
pter01130  Biosynthesis of antibiotics
pter01200  Carbon metabolism
Module
pter_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pter_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pter_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pter00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C2L65_40505
   00650 Butanoate metabolism
    C2L65_40505
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    C2L65_40505
Enzymes [BR:pter01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     C2L65_40505
    1.3.5.4  fumarate reductase (quinol)
     C2L65_40505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C FAD_binding_3 DAO Thi4 Pyr_redox_2 GIDA HI0933_like FAD_oxidored Lycopene_cycl Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AUT65778
UniProt: A0A2I8EV56
LinkDB All DBs
Position
3:complement(2403028..2404803)
Genome map
AA seq 591 aa AA seqDB search
MAAIKNSLPRRKFDVVIVGAGGSGMRASLQLARAGLSVCVLSKVFPTRSHTVAAQGGIGA
SLGNMSEDNWHYHFYDTIKGSDWLGDQDAIEFMCREAPNAVYELEHFGMPFDRNADGTIY
QRPFGGHTANYGEKPVQRACAAADRTGHALLHTLYQQNVAAKTTFFVEWMALDLIRDAEG
DVLGVTALEMETGDVYILEGKTTLFATGGAGRIFAASTNAFINTGDGLGMAARAGIPLED
MEFWQFHPTGVAGAGVLITEGVRGEGGILRNSDGERFMERYAPTLKDLAPRDFVSRSMDQ
EIKEGRGVGPNKDHVLLDLSHIGAETIMKRLPSIREIALKFANVDCIKEPIPVVPTIHYQ
MGGIPTNIHGQVVGTAKGHEDPINGFYAVGECSCVSVHGANRLGTNSLLDLVVFGRAAGN
HIVKHVKDIKEHKPLPADAADFALSRLAKLDNSSSGEYAQNVANDIRSTMQAHAGVFRTS
ALLAEGVERIREVAARVGNIHLKDKSKVFNTARVEALEVENLIEVARATMVSAEARKESR
GAHAQNDFEHRDDENWLRHTLWYSEGDRLDYKPVHMNPLTVESVPPKARTF
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaatcaagaattccctgccgcgtcgcaagtttgatgtggtgatcgtcggcgca
ggtggctccgggatgcgcgcatcgctgcaactggcacgcgcgggcctgtccgtgtgcgtg
ctctcgaaggtgttcccgacgcgctcgcacacggtggctgcgcaaggcggcatcggcgcc
tcgctcggcaacatgagcgaagacaactggcactaccacttctacgacacgatcaagggc
tccgactggctcggcgaccaggacgcgatcgagttcatgtgccgcgaagcaccgaacgcc
gtctacgaactcgaacacttcggcatgccgttcgaccgtaacgcggatggcacgatctac
cagcgcccgttcggtggtcacacggcgaactacggcgagaagcccgtgcagcgcgcttgc
gctgccgctgaccgtaccggccacgcactgctgcacacgctgtaccagcagaacgtcgca
gcgaagaccacgttcttcgtcgaatggatggcgctggacctgatccgcgacgccgaaggc
gacgtgctcggcgtgaccgcgctggaaatggaaacgggcgacgtctatatcctcgaaggc
aagaccacgctgttcgccacgggcggcgcggggcggatcttcgcggcctcgaccaatgcg
ttcatcaacacgggcgacggtctgggcatggccgcacgcgcgggcatcccgctcgaagac
atggaattctggcaattccacccgacgggtgtcgccggtgcgggcgtgctgattacggaa
ggcgtgcgcggcgaaggcggcatcctgcgtaactcggacggcgagcgcttcatggagcgc
tacgcgccgaccttgaaggatctggcgccgcgcgacttcgtttcgcgctcgatggaccag
gaaatcaaggaaggccgtggcgtcggtccgaacaaggaccacgtgctgctcgacctgtcg
cacatcggcgccgagacgatcatgaagcgtctgccgtcgatccgcgagatcgcgctgaag
ttcgcgaacgtcgactgcatcaaggaaccgattcccgttgtgccgaccatccactaccag
atgggcggcattccgacgaacattcacggtcaggtggtcggtacggccaagggccacgaa
gacccgatcaacggcttctacgccgtgggcgaatgctcgtgcgtgtcggtgcatggcgcg
aaccgcctgggcacgaactcgctgctggatctcgtggtgttcggccgcgcggcgggtaac
cacatcgtcaagcacgtgaaggacatcaaggagcacaagccgctgccggccgatgccgct
gatttcgcgctgtcgcgtctggcgaagctggacaactccagctcgggcgaatacgcgcag
aacgtggcgaacgacatccgctcgacgatgcaggcgcacgcaggcgtgttccgtacgtcg
gcgctgctcgccgaaggcgtcgagcgcattcgcgaagtggctgcacgcgtgggcaatatc
cacctgaaggacaagtcgaaggtgttcaacacggcgcgcgtggaagcgctcgaagtggag
aacctgatcgaagtggcgcgcgcgacgatggtgtcggcggaagcgcgcaaggaaagccgt
ggcgcgcatgcgcagaacgacttcgaacatcgcgacgacgagaactggctgcgccatacg
ctgtggtacagcgaaggcgaccgcctcgactacaagccggtacatatgaacccgctgacg
gtcgaatcggtgccgccgaaggcacggaccttctaa

DBGET integrated database retrieval system