KEGG   Panthera tigris altaica (Amur tiger): 102948492Help
Entry
102948492         CDS       T02988                                 

Gene name
BTK
Definition
(RefSeq) Bruton tyrosine kinase
  KO
K07370  Bruton agammaglobulinemia tyrosine kinase [EC:2.7.10.2]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04064  NF-kappa B signaling pathway
ptg04380  Osteoclast differentiation
ptg04611  Platelet activation
ptg04662  B cell receptor signaling pathway
ptg04664  Fc epsilon RI signaling pathway
ptg05169  Epstein-Barr virus infection
ptg05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    102948492 (BTK)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102948492 (BTK)
   04662 B cell receptor signaling pathway
    102948492 (BTK)
   04664 Fc epsilon RI signaling pathway
    102948492 (BTK)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102948492 (BTK)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    102948492 (BTK)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    102948492 (BTK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptg01001]
    102948492 (BTK)
Enzymes [BR:ptg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     102948492 (BTK)
Protein kinases [BR:ptg01001]
 Non-receptor tyrosine kinases
  TEC family
   102948492 (BTK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 SH3_1 PH BTK SH3_9 SH3_2 Kinase-like SH3_3 Haspin_kinase Pkinase_fungal SH3_10 APH Kdo SH3_4
Motif
Other DBs
NCBI-GeneID: 102948492
NCBI-ProteinID: XP_007094141
LinkDB All DBs
Position
Un
AA seq 659 aa AA seqDB search
MATVILESIFLKRSQQKKKTSPLNFKKRLFLLTVNKLSYYEYDFERGRRGSKKGSIDIEK
ITCVETVVPEKNPPPERQIPRRGEESSEMEQISIIERFPYPFQVVYDEGPLYVFSPTEEL
RKRWIHQLKNVIRYNSDLAQKYHPCFWIDGQYLCCSQTAKNAMGCQILENRNGSLKPGSS
HRKTKKPLPPTPEEDQILKKPLPPEPTAPPASPSELKKVVALYDYLPMNANDLQLRKGDE
YFILEESNLPWWRARDKNGQEGYIPSNYVTEAEDSIEMYEWYSKHMTRSQAEQLLKQEGK
EGGFIVRDSSKAGKYTVSVFAKSTGDSQGVIRHYVVCSTPQSQYYLAEKHLFSTIPELIN
YHQHNSAGLISRLKYPVSQQNKNAPSTAGLGYGSWEIDPKDLTFLKELGTGQFGVVKYGK
WRGQYDVAIKMIKEGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITEYMANG
CLLNYLREMRHRLQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVKVSDF
GLSRYVLDDEYTSSVGSKFPVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYER
FSNSETAEHIAQGLRLYRPHLASERVYSIMYSCWHEKAEERPTFKILLSNILDVMDEES
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atggctacagtgatactggagagcatctttctcaagcgatcccaacagaaaaagaaaaca
tcacctttaaacttcaagaagcgcctctttctcttgactgtgaataaactttcctattat
gagtatgactttgaacgtgggagaagaggcagtaagaagggttcaatagatattgagaag
atcacctgcgttgaaacagtggttcctgaaaaaaatcctccccctgaaagacagattccg
agaaggggtgaagaatccagtgaaatggagcagatttcaatcattgaaaggttcccttat
cccttccaggttgtatatgatgaagggcctctttatgtcttctccccaactgaagaactg
aggaagcgctggattcatcagctcaaaaatgtaatccggtacaacagtgatctggcacag
aaataccatccttgcttctggatcgatgggcagtatctctgctgctctcagacagccaaa
aatgctatgggctgccaaattttggagaataggaatggaagtttaaaacctgggagttct
caccgaaagacgaaaaagccccttcctcccacacctgaagaggaccagatcttgaaaaag
cctctgccccctgagccaacagcaccacctgcctctccaagtgagctgaaaaaggttgta
gccctttatgattacctgccaatgaatgcaaatgatctacagctacgaaagggtgatgag
tattttatcctggaggagagcaacttaccctggtggagagcgcgggataaaaatgggcag
gaaggctacattcctagtaactatgtcaccgaagcagaagactccatagaaatgtatgag
tggtattctaaacacatgactcggagtcaagctgagcaactgctaaagcaagaggggaaa
gaaggaggtttcattgtcagagactccagcaaagcaggaaaatatactgtgtctgtgttt
gctaaatctacaggggactctcaaggggtgatacgccattatgttgtgtgttccacacct
cagagccagtattacctggctgagaagcaccttttcagcaccatccctgaactcattaac
taccatcagcataactctgcaggactcatatctaggctcaaatatccagtgtctcaacaa
aacaagaatgcgccttccactgcaggcctgggctacggatcatgggaaatcgatccaaag
gacctgaccttcttaaaggagctggggactggacaatttggggtagtgaaatatggaaaa
tggagaggccagtatgacgtggccatcaagatgatcaaagaaggctccatgtccgaggat
gagttcattgaagaagccaaagtcatgatgaatctttcccatgagaagctggtacagttg
tatggcgtctgtaccaagcagcgccccatcttcatcatcactgagtacatggccaatggc
tgcctcctgaactacctgagggaaatgcgccaccgcctccagactcagcagctgctggag
atgtgcaaggatgtctgtgaagccatggaatacctggagtcaaagcaatttcttcaccga
gacctggcagcccgaaactgtttggtaaatgatcaaggagttgttaaagtatctgacttc
ggcctgtccaggtatgtcctggatgatgaatacacaagctcagtaggctccaaatttcca
gtccggtggtctccaccagaagtccttatgtatagcaagttcagcagcaaatctgacatc
tgggcttttggggttttgatgtgggaaatttactctctggggaagatgccatatgaaaga
ttttctaacagtgaaacagctgaacacattgcacaaggtctacgtctctataggcctcat
ctagcttcagagagggtatatagcatcatgtacagctgctggcatgagaaagcagaggaa
cgtcctactttcaaaattcttctgagcaacatcctagatgtcatggatgaagaatcctga

DBGET integrated database retrieval system