KEGG   Panthera tigris altaica (Amur tiger): 102948983Help
Entry
102948983         CDS       T02988                                 

Gene name
PRKACA
Definition
(RefSeq) protein kinase cAMP-activated catalytic subunit alpha
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01522  Endocrine resistance
ptg04010  MAPK signaling pathway
ptg04014  Ras signaling pathway
ptg04020  Calcium signaling pathway
ptg04024  cAMP signaling pathway
ptg04062  Chemokine signaling pathway
ptg04114  Oocyte meiosis
ptg04140  Autophagy - animal
ptg04211  Longevity regulating pathway
ptg04213  Longevity regulating pathway - multiple species
ptg04261  Adrenergic signaling in cardiomyocytes
ptg04270  Vascular smooth muscle contraction
ptg04310  Wnt signaling pathway
ptg04340  Hedgehog signaling pathway
ptg04371  Apelin signaling pathway
ptg04530  Tight junction
ptg04540  Gap junction
ptg04611  Platelet activation
ptg04713  Circadian entrainment
ptg04714  Thermogenesis
ptg04720  Long-term potentiation
ptg04723  Retrograde endocannabinoid signaling
ptg04724  Glutamatergic synapse
ptg04725  Cholinergic synapse
ptg04726  Serotonergic synapse
ptg04727  GABAergic synapse
ptg04728  Dopaminergic synapse
ptg04740  Olfactory transduction
ptg04742  Taste transduction
ptg04750  Inflammatory mediator regulation of TRP channels
ptg04910  Insulin signaling pathway
ptg04911  Insulin secretion
ptg04912  GnRH signaling pathway
ptg04913  Ovarian steroidogenesis
ptg04914  Progesterone-mediated oocyte maturation
ptg04915  Estrogen signaling pathway
ptg04916  Melanogenesis
ptg04918  Thyroid hormone synthesis
ptg04919  Thyroid hormone signaling pathway
ptg04921  Oxytocin signaling pathway
ptg04922  Glucagon signaling pathway
ptg04923  Regulation of lipolysis in adipocytes
ptg04924  Renin secretion
ptg04925  Aldosterone synthesis and secretion
ptg04926  Relaxin signaling pathway
ptg04927  Cortisol synthesis and secretion
ptg04928  Parathyroid hormone synthesis, secretion and action
ptg04934  Cushing syndrome
ptg04935  Growth hormone synthesis, secretion and action
ptg04961  Endocrine and other factor-regulated calcium reabsorption
ptg04962  Vasopressin-regulated water reabsorption
ptg04970  Salivary secretion
ptg04971  Gastric acid secretion
ptg04976  Bile secretion
ptg05012  Parkinson disease
ptg05020  Prion diseases
ptg05030  Cocaine addiction
ptg05031  Amphetamine addiction
ptg05032  Morphine addiction
ptg05034  Alcoholism
ptg05146  Amoebiasis
ptg05163  Human cytomegalovirus infection
ptg05165  Human papillomavirus infection
ptg05166  Human T-cell leukemia virus 1 infection
ptg05200  Pathways in cancer
ptg05203  Viral carcinogenesis
ptg05205  Proteoglycans in cancer
ptg05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102948983 (PRKACA)
   04010 MAPK signaling pathway
    102948983 (PRKACA)
   04310 Wnt signaling pathway
    102948983 (PRKACA)
   04340 Hedgehog signaling pathway
    102948983 (PRKACA)
   04371 Apelin signaling pathway
    102948983 (PRKACA)
   04020 Calcium signaling pathway
    102948983 (PRKACA)
   04024 cAMP signaling pathway
    102948983 (PRKACA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102948983 (PRKACA)
  09143 Cell growth and death
   04114 Oocyte meiosis
    102948983 (PRKACA)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102948983 (PRKACA)
   04540 Gap junction
    102948983 (PRKACA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102948983 (PRKACA)
   04062 Chemokine signaling pathway
    102948983 (PRKACA)
  09152 Endocrine system
   04911 Insulin secretion
    102948983 (PRKACA)
   04910 Insulin signaling pathway
    102948983 (PRKACA)
   04922 Glucagon signaling pathway
    102948983 (PRKACA)
   04923 Regulation of lipolysis in adipocytes
    102948983 (PRKACA)
   04912 GnRH signaling pathway
    102948983 (PRKACA)
   04913 Ovarian steroidogenesis
    102948983 (PRKACA)
   04915 Estrogen signaling pathway
    102948983 (PRKACA)
   04914 Progesterone-mediated oocyte maturation
    102948983 (PRKACA)
   04921 Oxytocin signaling pathway
    102948983 (PRKACA)
   04926 Relaxin signaling pathway
    102948983 (PRKACA)
   04935 Growth hormone synthesis, secretion and action
    102948983 (PRKACA)
   04918 Thyroid hormone synthesis
    102948983 (PRKACA)
   04919 Thyroid hormone signaling pathway
    102948983 (PRKACA)
   04928 Parathyroid hormone synthesis, secretion and action
    102948983 (PRKACA)
   04916 Melanogenesis
    102948983 (PRKACA)
   04924 Renin secretion
    102948983 (PRKACA)
   04925 Aldosterone synthesis and secretion
    102948983 (PRKACA)
   04927 Cortisol synthesis and secretion
    102948983 (PRKACA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102948983 (PRKACA)
   04270 Vascular smooth muscle contraction
    102948983 (PRKACA)
  09154 Digestive system
   04970 Salivary secretion
    102948983 (PRKACA)
   04971 Gastric acid secretion
    102948983 (PRKACA)
   04976 Bile secretion
    102948983 (PRKACA)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    102948983 (PRKACA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    102948983 (PRKACA)
  09156 Nervous system
   04724 Glutamatergic synapse
    102948983 (PRKACA)
   04727 GABAergic synapse
    102948983 (PRKACA)
   04725 Cholinergic synapse
    102948983 (PRKACA)
   04728 Dopaminergic synapse
    102948983 (PRKACA)
   04726 Serotonergic synapse
    102948983 (PRKACA)
   04720 Long-term potentiation
    102948983 (PRKACA)
   04723 Retrograde endocannabinoid signaling
    102948983 (PRKACA)
  09157 Sensory system
   04740 Olfactory transduction
    102948983 (PRKACA)
   04742 Taste transduction
    102948983 (PRKACA)
   04750 Inflammatory mediator regulation of TRP channels
    102948983 (PRKACA)
  09149 Aging
   04211 Longevity regulating pathway
    102948983 (PRKACA)
   04213 Longevity regulating pathway - multiple species
    102948983 (PRKACA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102948983 (PRKACA)
   04714 Thermogenesis
    102948983 (PRKACA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102948983 (PRKACA)
   05205 Proteoglycans in cancer
    102948983 (PRKACA)
   05203 Viral carcinogenesis
    102948983 (PRKACA)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    102948983 (PRKACA)
   05020 Prion diseases
    102948983 (PRKACA)
  09165 Substance dependence
   05030 Cocaine addiction
    102948983 (PRKACA)
   05031 Amphetamine addiction
    102948983 (PRKACA)
   05032 Morphine addiction
    102948983 (PRKACA)
   05034 Alcoholism
    102948983 (PRKACA)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    102948983 (PRKACA)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102948983 (PRKACA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102948983 (PRKACA)
   05163 Human cytomegalovirus infection
    102948983 (PRKACA)
   05165 Human papillomavirus infection
    102948983 (PRKACA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102948983 (PRKACA)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102948983 (PRKACA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptg01001]
    102948983 (PRKACA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ptg03019]
    102948983 (PRKACA)
   03036 Chromosome and associated proteins [BR:ptg03036]
    102948983 (PRKACA)
Enzymes [BR:ptg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     102948983 (PRKACA)
Protein kinases [BR:ptg01001]
 Serine/threonine kinases: AGC group
  PKA family
   102948983 (PRKACA)
Messenger RNA biogenesis [BR:ptg03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     102948983 (PRKACA)
Chromosome and associated proteins [BR:ptg03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    102948983 (PRKACA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 102948983
NCBI-ProteinID: XP_007098199
LinkDB All DBs
Position
Un
AA seq 360 aa AA seqDB search
MGPSSLYPSPPFPLHPLLEEVGSRVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLG
TGSFGRVMLVKHKETGNHFAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSF
KDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPE
NLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYE
MAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVND
IKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFTEF
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgggtcccagctcactctatccctctccacctttcccattgcaccctctgctggaagag
gtaggaagcagagtgaaagagttcttagccaaagccaaagaagattttcttaaaaaatgg
gaaaatcctgctcagaatacagcccatttggatcagtttgaacgaatcaagaccctcggc
acgggctcctttgggcgggtgatgctggtaaagcacaaggagaccgggaaccactttgcc
atgaagatcctcgacaaacagaaggtggtgaagctgaaacagattgagcacaccctgaac
gaaaagcgcatcctgcaagcggtcaactttccgttcctcgtcaaactcgagttctccttc
aaggacaactcgaacttatacatggtcatggagtacgtgcctggcggggagatgttctca
cacctgcggcggattggaaggttcagtgaacctcacgcgcgcttttatgcggcccagatc
gtcctgaccttcgagtacctgcactcacttgacctcatctaccgggacctgaagccggag
aacctcctcattgaccagcagggctacattcaggtgacagacttcggttttgccaagcgt
gtaaaaggccgcacctggaccttatgcgggacccctgagtacctggccccggagatcatc
ctgagcaaaggctacaacaaggccgtggactggtgggccctaggggttctcatctacgag
atggccgctggctacccgcctttcttcgctgaccagcccatccagatctatgagaagatt
gtctctgggaaggtgcggttcccatcccacttcagctccgacctgaaggatctgctgcgg
aacctactgcaggtggacctcaccaaacgctttgggaacctcaagaatggagtcaacgat
atcaagaaccacaaatggtttgccacaactgactggatcgccatctaccagaggaaggtg
gaagctcccttcataccaaagtttaaaggccctggggacacgagtaatttcgacgactat
gaggaggaagagatccgagtctccatcaatgagaagtgtggcaaggagtttactgagttt
tag

DBGET integrated database retrieval system