KEGG   Panthera tigris altaica (Amur tiger): 102949153
Entry
102949153         CDS       T02988                                 

Gene name
BAX
Definition
(RefSeq) BCL2 associated X, apoptosis regulator
  KO
K02159  apoptosis regulator BAX
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01521  EGFR tyrosine kinase inhibitor resistance
ptg01522  Endocrine resistance
ptg01524  Platinum drug resistance
ptg04071  Sphingolipid signaling pathway
ptg04115  p53 signaling pathway
ptg04141  Protein processing in endoplasmic reticulum
ptg04210  Apoptosis
ptg04211  Longevity regulating pathway
ptg04215  Apoptosis - multiple species
ptg04217  Necroptosis
ptg04722  Neurotrophin signaling pathway
ptg04932  Non-alcoholic fatty liver disease
ptg04933  AGE-RAGE signaling pathway in diabetic complications
ptg05012  Parkinson disease
ptg05014  Amyotrophic lateral sclerosis
ptg05016  Huntington disease
ptg05020  Prion disease
ptg05022  Pathways of neurodegeneration - multiple diseases
ptg05132  Salmonella infection
ptg05152  Tuberculosis
ptg05160  Hepatitis C
ptg05161  Hepatitis B
ptg05162  Measles
ptg05163  Human cytomegalovirus infection
ptg05164  Influenza A
ptg05165  Human papillomavirus infection
ptg05166  Human T-cell leukemia virus 1 infection
ptg05167  Kaposi sarcoma-associated herpesvirus infection
ptg05168  Herpes simplex virus 1 infection
ptg05169  Epstein-Barr virus infection
ptg05170  Human immunodeficiency virus 1 infection
ptg05200  Pathways in cancer
ptg05202  Transcriptional misregulation in cancer
ptg05203  Viral carcinogenesis
ptg05210  Colorectal cancer
ptg05212  Pancreatic cancer
ptg05213  Endometrial cancer
ptg05214  Glioma
ptg05216  Thyroid cancer
ptg05217  Basal cell carcinoma
ptg05218  Melanoma
ptg05220  Chronic myeloid leukemia
ptg05222  Small cell lung cancer
ptg05223  Non-small cell lung cancer
ptg05224  Breast cancer
ptg05225  Hepatocellular carcinoma
ptg05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102949153 (BAX)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    102949153 (BAX)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102949153 (BAX)
   04215 Apoptosis - multiple species
    102949153 (BAX)
   04217 Necroptosis
    102949153 (BAX)
   04115 p53 signaling pathway
    102949153 (BAX)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102949153 (BAX)
  09149 Aging
   04211 Longevity regulating pathway
    102949153 (BAX)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102949153 (BAX)
   05202 Transcriptional misregulation in cancer
    102949153 (BAX)
   05203 Viral carcinogenesis
    102949153 (BAX)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102949153 (BAX)
   05212 Pancreatic cancer
    102949153 (BAX)
   05225 Hepatocellular carcinoma
    102949153 (BAX)
   05226 Gastric cancer
    102949153 (BAX)
   05214 Glioma
    102949153 (BAX)
   05216 Thyroid cancer
    102949153 (BAX)
   05220 Chronic myeloid leukemia
    102949153 (BAX)
   05217 Basal cell carcinoma
    102949153 (BAX)
   05218 Melanoma
    102949153 (BAX)
   05213 Endometrial cancer
    102949153 (BAX)
   05224 Breast cancer
    102949153 (BAX)
   05222 Small cell lung cancer
    102949153 (BAX)
   05223 Non-small cell lung cancer
    102949153 (BAX)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    102949153 (BAX)
   05014 Amyotrophic lateral sclerosis
    102949153 (BAX)
   05016 Huntington disease
    102949153 (BAX)
   05020 Prion disease
    102949153 (BAX)
   05022 Pathways of neurodegeneration - multiple diseases
    102949153 (BAX)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102949153 (BAX)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102949153 (BAX)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102949153 (BAX)
   05152 Tuberculosis
    102949153 (BAX)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102949153 (BAX)
   05170 Human immunodeficiency virus 1 infection
    102949153 (BAX)
   05161 Hepatitis B
    102949153 (BAX)
   05160 Hepatitis C
    102949153 (BAX)
   05164 Influenza A
    102949153 (BAX)
   05162 Measles
    102949153 (BAX)
   05168 Herpes simplex virus 1 infection
    102949153 (BAX)
   05163 Human cytomegalovirus infection
    102949153 (BAX)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102949153 (BAX)
   05169 Epstein-Barr virus infection
    102949153 (BAX)
   05165 Human papillomavirus infection
    102949153 (BAX)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102949153 (BAX)
   01524 Platinum drug resistance
    102949153 (BAX)
   01522 Endocrine resistance
    102949153 (BAX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ptg03029]
    102949153 (BAX)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ptg02000]
    102949153 (BAX)
Mitochondrial biogenesis [BR:ptg03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    102949153 (BAX)
Transporters [BR:ptg02000]
 Other transporters
  Pores ion channels [TC:1]
   102949153 (BAX)
SSDB
Motif
Pfam: Bcl-2 CF222
Other DBs
NCBI-GeneID: 102949153
NCBI-ProteinID: XP_007074210
LinkDB
Position
Un
AA seq 205 aa
MSHPSSLNPLGPKSPGTSSLLSPLGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELAL
EQVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAAEMFSDGNFNW
GRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGT
PTWQTVTIFVAGVLTASLTIWKKMG
NT seq 618 nt   +upstreamnt  +downstreamnt
atgagccaccctagttccctgaatcccctaggacccaagagtccaggcacgtcttccctc
ctttctcctctagggcccaccagctctgagcagatcatgaagacaggggcccttttgctt
cagggtttcatccaagatcgggcagggcgaatggggggagagacacccgagctggccctg
gagcaggtgccccaggatgcgtccaccaagaagctgagcgagtgtctcaagcgcatcgga
gatgaactggacagtaacatggaattgcagaggatgatcgcagctgtggacacagactcc
ccccgcgaggtctttttccgagtggcagcggagatgttttccgatggcaacttcaactgg
ggccgggtcgttgccctcttctactttgccagcaaactggtgctcaaggccctgtgtacc
aaggtgcccgagctgatccggaccatcatgggctggacactggacttccttcgagagcgg
ctgctgggctggatccaggaccagggtggttgggacggcctcctctcctactttgggaca
cccacgtggcagacagtgaccatctttgtggccggagtgctgactgcgtcactcaccatc
tggaaaaagatgggctga

DBGET integrated database retrieval system