KEGG   Panthera tigris altaica (Amur tiger): 102949288Help
Entry
102949288         CDS       T02988                                 

Gene name
LCT
Definition
(RefSeq) lactase
  KO
K01229  lactase-phlorizin hydrolase [EC:3.2.1.108 3.2.1.62]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00052  Galactose metabolism
ptg01100  Metabolic pathways
ptg04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:ptg00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    102949288 (LCT)
 Organismal Systems
  Digestive system
   04973 Carbohydrate digestion and absorption
    102949288 (LCT)
Enzymes [BR:ptg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.62  glycosylceramidase
     102949288 (LCT)
    3.2.1.108  lactase
     102949288 (LCT)
Chaperones and folding catalysts [BR:ptg03110]
 Intramolecular chaperones
  Others
   102949288 (LCT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-GeneID: 102949288
NCBI-ProteinID: XP_007098909
LinkDB All DBs
Position
Un
AA seq 1931 aa AA seqDB search
MELAWNSVFIVLLSFSCWGLDWESDRKFISAAGPLTNDLLYNLSDPLGNQRSNFAAEDRS
IYVCRQPLPAFLPKFFNSVRASKITHYKVFLPWAQLLPTGSSKNPDSKTVQCYRQLLETL
KTAQLQPLVVLHHQTLPASTVQRREVFADLFADYATFAFNSFGDLVKIWFTFSDLEEVIK
EFPHQESRPSHLQTLTDAHRKAYEIYHEKYASQGGKLSVVLRAEAVSELLLEPSTCALAK
GTVDFLSLDLFYECQSEASLPQKLSKLQTVEPKVKIFIFNLRFQDCPSTRKKSARLLFSL
LEAINKSQVITIGFDLNTFLSCSSSKKRSGPCSRTDSAPLQTAAQPALGTAVGSSSPRGS
AYRRVWGTFANQSTAERDAFLREDFPEGFLWGVSTGAFNVEGGWAEGGRGPSVWDHLGRR
HASKGAATPEVASDSYHKVDNDVALLRGLQAHVYKFSISWSRIFPTGLGPGPSRQGVAYY
SRLIDSLLDARIQPMATRFHWDLPQALQERGGWQDDSVVDAFLDYAAFCFATFGDRVKLW
VTFHEPWVMSYAGYGTGRHAPGISDPGVASFKVAHLVLKAHARVWHHYNSYYRPQQQGRV
GIVLNSDWAEPLSPKRPEDLSASERFLHFMLGWFAHPIFVDGDYPAALKAQIQQMNQQCP
SLVVQLPEFTKAEKQLLKGSADFLGLSHYTSRLISTAQQDSCIPSYDTIGGFSQHVDPAW
PQTSSPWIYVVPWGIRRLLQFVSLEYTRGKVPIYLAGNGMPIGETEDLLEDSLRVDYFNK
YINEVLKAIKEDLVDVRSYIARALMDGFEGPFGYSQRFGLYHVNFNDSSKPRTPRKSAYF
FTSIIEKNGFLPKAVKRLPPPSLANFPRKIRAFTFPSDVPSKAKVVWEKFSNQPKFERDL
FYHGTFREDFLWGVSSSAYQIEGAWNADGKGPSIWDNFTHTPGSNVKGNATGDIACDSYN
QLDADLNMLRALKVKAYRFSISWSRIFPTGRNSSINRHGVDYYNRLINGLVASNISPMVT
LFHWDLPQALQDIGGWENPSLIELFNSYADFCFQTFGDRVKFWMTFNEPTYQAWLGYGSG
DFPPKVKDPGWGPYRIGHAIIKAHARVYHTYDEKYRQEQKGVISLSLSAHWAEPKSPEIP
RDVEAADRVLQFSLGWFAHPIFRNGDYPDAMKWKVGNRSELQHLATSRLPSFTEEEKRYI
RATADVFCLNTYSSRIVQHKTPRLNPPSYEDDQEATKEEDPSWPSTAINRAAPWGTRRLL
NWIKEEYGDIPIYITENGVGLTNPKVEDTDRIFYHKTYINEALKAYRLDGVDLRGYSAWS
LMDNFEWLNGYTVKFGLYHVDFNNMNRPRTARASARYYTEVITNNGMPLSREDEFVYGQF
PEGFIWSAASAAYQIEGAWRADGKGLSIWDTFSHTPLKVGNDDTGDVACDSYHKIAEDVV
ALQNLAVSHYRFSISWSRILPDGTTKYINEAGLNYYVRLIDALLAANIKPQVTIYHWDLP
QALQDVGGWENDTIVQRFKEYADVLFQRLGDKVKFWITLNEPFVIANQGYGYGTSAPGIS
FRPGTAPYVVGHNLIKAHAEAWHLYNDVYRASQGGVISITINSDWAEPRDPSNQEDVEAA
RRYVQFMGGWFAHPIFKNGDYNEVMKTRIRDRSLAAGLSKSRLPEFTESEKRKINGTYDF
FGFNHYTTVLAYNLDYASWISSFDADRGVASITDRSWPDSGSFWLKVTPFGFRKILNWIK
EEYNNPLIYVTENGVSQRGETDLNDTLRISYLRSYINEALKATVQDKVDLRGYTVWSVMD
NFEWATGFAERFGLHFVNYTDPSLPRIPKASAKLFASIVRCNGFPNPAAGPHPCLQPEDA
GPTVSPMQEEEVQFLGLTLGVTEAQTALYVLFSLVILGVCCVTFLSYKYCKRSKQGKTQP
GRQELNTLSAF
NT seq 5796 nt NT seq  +upstreamnt  +downstreamnt
atggagctggcctggaattcagtctttattgtcctcctgagcttttcgtgctgggggtta
gattgggaatctgatagaaaattcatttcagctgctggtcctctcaccaatgacttgcta
tacaacttgagtgatccactgggaaaccagcgttctaattttgcagcagaggacagaagc
atttatgtttgtcgccaaccactgcccgctttcctgccgaagttctttaatagtgttcgt
gccagtaagatcacccattacaaagtatttcttccatgggcacaacttctcccaacggga
agctccaagaacccagacagcaaaacagtgcagtgctaccggcaactccttgagactctc
aagaccgcacagcttcagcccctggtcgttctgcatcaccagacccttcctgccagcacg
gtccagagaagagaagtctttgctgatctctttgcggactatgccacattcgccttcaac
tcctttggggacctggttaagatctggttcacgtttagtgacttggaggaggtgataaaa
gagtttccacaccaggaatcaagaccttcacatctccagaccctcactgatgcccacaga
aaagcctatgagatttaccatgaaaaatatgcttctcaaggcggaaaactctctgtggtc
ctgcgagctgaagcagtctcggagctcctgctggaaccgtccacgtgtgctcttgccaag
ggcaccgtcgatttcctctctcttgatttgttttatgaatgccaaagtgaggcaagtttg
ccacagaagttgagtaaattgcagactgttgagccaaaagtaaaaattttcatcttcaat
ctaagattccaggactgcccctccaccaggaagaagtcagccagactgctcttcagcctt
ctcgaggccataaataaaagccaagtgatcaccattgggtttgatctcaatactttcctg
agctgttcaagttccaagaaacgcagcgggccctgctctcggacagacagcgcgcccctc
cagaccgccgcgcagcctgccctagggacggcagtaggttcctcctcgccgcggggctcc
gcctaccggagagtctggggaacatttgccaaccaatccacggccgaaagggacgctttc
ctgcgggaggatttccccgaaggcttcctctggggcgtctccacgggagcctttaacgtg
gaaggaggctgggccgagggcggaagagggccgagcgtctgggaccacctgggtcgccgg
cacgcctccaagggcgcagcaacaccggaggtggccagtgacagctaccacaaggtggac
aacgatgtggccctgcttcgcggcctccaagctcacgtctacaagttctccatctcctgg
tcccgcatcttccccacggggctcgggcccggacccagccgccagggcgtcgcctactac
agcaggctcatcgacagcctgctggacgcgcgcatccagcccatggccacgcgcttccac
tgggacctgccccaggccctgcaggagcgcggcgggtggcaggacgacagtgtggtggac
gccttcctggactacgcggctttttgcttcgccaccttcggggaccgcgtgaagctgtgg
gtgaccttccatgagccgtgggtgatgagctacgcgggctacggcactggccgacacgca
ccgggcatctccgacccgggcgtggcttctttcaaggtggctcacttggtcctcaaggct
catgccagagtttggcaccactataatagctactatcgtccacagcagcagggacgtgtg
ggcattgtattgaactcagactgggcagaacctctgtccccaaagaggcctgaggacctg
agtgcctctgaacgcttcttgcacttcatgctgggctggtttgcacaccccatctttgtg
gatggagactaccctgctgccctgaaggcccaaatccaacagatgaaccaacagtgcccc
agtcttgtggtccagctccctgagttcaccaaggcagagaagcaactcctgaaaggctct
gctgattttctgggtctgtctcattacacttctcgccttatcagcacggcccaacaagat
tcctgcatccctagctatgacaccattggaggcttttcccagcatgtggaccctgcatgg
ccccagacctcatccccttggatttatgtggtgccctggggtataaggaggctattgcag
tttgtatctttggaatacacaagaggaaaagttccgatctacctggctgggaatggcatg
cccataggggagactgaagatctccttgaggattccttgagagtagactacttcaataaa
tatatcaatgaggtgctcaaagctatcaaggaggacttagtggatgttcgatcttacatc
gctcgtgccctcatggatggctttgaaggcccctttggttacagccagaggtttggactg
tatcatgtcaacttcaatgacagcagcaagccaaggactcccaggaaatctgcctacttt
ttcaccagcatcattgaaaagaacggtttcctccccaaggcagtaaagagactgccacca
cccagtttagcaaacttcccacgtaaaatcagagccttcacttttccatctgatgtgccc
tccaaagctaaagtagtttgggaaaagttctccaaccaacccaagtttgaaagagatttg
ttctaccatggtactttcagagaggactttctctggggcgtgtcctcatcagcctatcag
attgaaggagcttggaatgctgatggcaaaggccccagcatctgggataacttcacccac
acaccagggagcaatgtgaaaggcaatgccactggagacatcgcctgtgacagctataac
caactggatgccgatctgaatatgcttcgagctttgaaggtgaaggcctatcgcttctct
atctcctggtctcggattttcccaacagggagaaacagttctatcaacagacacggtgtt
gattattacaacaggctgatcaatggcttggtggcaagcaacatctctcccatggtgaca
ctgttccactgggacctgccccaggccctccaggatattggaggctgggaaaatccttcc
ttgattgagttgtttaacagctatgcagacttttgtttccagacctttggggacagagtc
aagttctggatgacctttaatgagcccacataccaggcatggttgggttacggctcaggg
gattttcctccaaaggtgaaagacccaggctggggaccttacagaattggccatgcaatc
atcaaagctcatgccagagtatatcacacttacgatgagaaatacaggcaggaacagaag
ggggtcatctctttgagcctcagtgcacactgggcagagcccaagtcccctgagatcccg
agggatgtggaggcagctgaccgagtgctgcagttctcactgggctggtttgcccacccc
attttccgaaacggagactatcccgatgccatgaagtggaaagtggggaacaggagtgag
cttcaacacttagccacctcccgcctgccaagcttcactgaggaagagaagaggtacatc
agggccacagctgacgtgttctgcctcaacacctactcctccagaattgtgcagcacaaa
acacccaggttaaacccaccctcctatgaagatgaccaggaggcaaccaaggaggaggac
ccttcatggccttccacagcaataaacagagctgcaccctgggggacacgaagactgctc
aactggatcaaggaagagtatggtgacatacccatttacatcactgaaaatggagtgggg
ctgacaaatccaaaagtggaagatactgataggatattttaccacaaaacctacatcaat
gaagctttgaaagcctaccgacttgatggtgtagaccttcgagggtattctgcatggtct
ctgatggacaactttgagtggctgaatggctacacagttaagtttgggctgtaccatgtt
gatttcaataacatgaacaggcctcgcacagcaagagcctctgccaggtactacacagag
gtcatcaccaacaacggcatgcccctgtccagggaagacgagtttgtctatggacagttt
cccgagggcttcatctggagtgcagcttccgccgcatatcagatcgaaggtgcatggaga
gcagatggcaaaggactcagtatttgggacacattttctcacacaccgctgaaggttgga
aatgatgacaccggagatgtggcctgtgacagttatcacaagattgctgaggacgtggtt
gccctgcagaacttggctgtctcccactatcgcttctccatctcctggtctcgtatcctc
ccggatggaaccacaaaatatatcaatgaagcaggcctcaactactacgtgcggctcatt
gacgcgctgctggctgccaacatcaagccccaggtgaccatttaccactgggacctgccc
caggcactccaggacgttggaggctgggagaatgacaccatcgtgcagcggtttaaagag
tatgcagacgtgctcttccagaggctgggagacaaggtgaagttttggatcactctgaat
gagccctttgtcatcgctaaccagggctatggctacgggacatcagctccaggaatctcc
tttaggcctggcactgccccctacgttgttggccacaacctaataaaggctcatgctgag
gcctggcatctgtacaatgatgtgtatcgtgccagtcaaggtggtgtgatttccattacc
atcaacagtgactgggctgagcccagagacccttccaaccaggaggatgtggaggcagcc
aggagatacgttcagttcatgggaggctggtttgcacatcctattttcaagaatggcgat
tacaacgaggtgatgaagacacggatccgtgacaggagcttggccgcaggcctcagcaag
tctcggctcccagagttcacggaaagtgagaagaggaagatcaatggcacttatgacttt
tttggattcaatcactacaccactgtcctggcctacaaccttgactatgcctcttggatc
tcttcctttgatgcagacagaggagttgcctccatcacagatcgttcttggccagactct
ggctccttctggttgaaggtgacaccttttggctttaggaagatactgaactggataaag
gaggagtacaacaaccccctaatttacgtaacagagaatggagtgtctcaacgtggagaa
actgacctcaacgacactctaaggatctcctacctccgcagttacatcaatgaggcgctc
aaagcaactgtgcaggataaggtggaccttcgaggatacacggtttggagtgtgatggac
aattttgagtgggccacaggcttcgcagagaggtttggtctgcattttgtgaactacacg
gacccttctctgccaaggatcccaaaagcatcagccaagctcttcgcctctatagtccgg
tgcaacggcttccctaaccctgcagcggggccacacccttgtctccagccagaagatgct
ggacctaccgtcagccccatgcaggaggaggaagttcagttcctggggttaacactaggt
gtgacggaagcccaaacagctttgtatgtactcttttctcttgtgattcttggcgtctgc
tgtgtgacatttctgtcatacaagtactgtaagcgctccaagcaagggaaaacacaacca
ggccgacaggaattgaacactctttctgcattctga

DBGET integrated database retrieval system