KEGG   Panthera tigris altaica (Amur tiger): 102949289
Entry
102949289         CDS       T02988                                 

Gene name
CHUK
Definition
(RefSeq) conserved helix-loop-helix ubiquitous kinase
  KO
K04467  inhibitor of nuclear factor kappa-B kinase subunit alpha [EC:2.7.11.10]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01523  Antifolate resistance
ptg04010  MAPK signaling pathway
ptg04014  Ras signaling pathway
ptg04062  Chemokine signaling pathway
ptg04064  NF-kappa B signaling pathway
ptg04068  FoxO signaling pathway
ptg04150  mTOR signaling pathway
ptg04151  PI3K-Akt signaling pathway
ptg04210  Apoptosis
ptg04380  Osteoclast differentiation
ptg04620  Toll-like receptor signaling pathway
ptg04621  NOD-like receptor signaling pathway
ptg04622  RIG-I-like receptor signaling pathway
ptg04623  Cytosolic DNA-sensing pathway
ptg04625  C-type lectin receptor signaling pathway
ptg04657  IL-17 signaling pathway
ptg04658  Th1 and Th2 cell differentiation
ptg04659  Th17 cell differentiation
ptg04660  T cell receptor signaling pathway
ptg04662  B cell receptor signaling pathway
ptg04668  TNF signaling pathway
ptg04920  Adipocytokine signaling pathway
ptg05010  Alzheimer disease
ptg05132  Salmonella infection
ptg05135  Yersinia infection
ptg05142  Chagas disease
ptg05145  Toxoplasmosis
ptg05160  Hepatitis C
ptg05161  Hepatitis B
ptg05162  Measles
ptg05163  Human cytomegalovirus infection
ptg05164  Influenza A
ptg05165  Human papillomavirus infection
ptg05166  Human T-cell leukemia virus 1 infection
ptg05167  Kaposi sarcoma-associated herpesvirus infection
ptg05168  Herpes simplex virus 1 infection
ptg05169  Epstein-Barr virus infection
ptg05170  Human immunodeficiency virus 1 infection
ptg05171  Coronavirus disease - COVID-19
ptg05200  Pathways in cancer
ptg05212  Pancreatic cancer
ptg05215  Prostate cancer
ptg05220  Chronic myeloid leukemia
ptg05221  Acute myeloid leukemia
ptg05222  Small cell lung cancer
ptg05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ptg05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102949289 (CHUK)
   04014 Ras signaling pathway
    102949289 (CHUK)
   04064 NF-kappa B signaling pathway
    102949289 (CHUK)
   04668 TNF signaling pathway
    102949289 (CHUK)
   04068 FoxO signaling pathway
    102949289 (CHUK)
   04151 PI3K-Akt signaling pathway
    102949289 (CHUK)
   04150 mTOR signaling pathway
    102949289 (CHUK)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102949289 (CHUK)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102949289 (CHUK)
   04621 NOD-like receptor signaling pathway
    102949289 (CHUK)
   04622 RIG-I-like receptor signaling pathway
    102949289 (CHUK)
   04623 Cytosolic DNA-sensing pathway
    102949289 (CHUK)
   04625 C-type lectin receptor signaling pathway
    102949289 (CHUK)
   04660 T cell receptor signaling pathway
    102949289 (CHUK)
   04658 Th1 and Th2 cell differentiation
    102949289 (CHUK)
   04659 Th17 cell differentiation
    102949289 (CHUK)
   04657 IL-17 signaling pathway
    102949289 (CHUK)
   04662 B cell receptor signaling pathway
    102949289 (CHUK)
   04062 Chemokine signaling pathway
    102949289 (CHUK)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102949289 (CHUK)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102949289 (CHUK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102949289 (CHUK)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102949289 (CHUK)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102949289 (CHUK)
   05221 Acute myeloid leukemia
    102949289 (CHUK)
   05220 Chronic myeloid leukemia
    102949289 (CHUK)
   05215 Prostate cancer
    102949289 (CHUK)
   05222 Small cell lung cancer
    102949289 (CHUK)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102949289 (CHUK)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102949289 (CHUK)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102949289 (CHUK)
   05135 Yersinia infection
    102949289 (CHUK)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102949289 (CHUK)
   05170 Human immunodeficiency virus 1 infection
    102949289 (CHUK)
   05161 Hepatitis B
    102949289 (CHUK)
   05160 Hepatitis C
    102949289 (CHUK)
   05171 Coronavirus disease - COVID-19
    102949289 (CHUK)
   05164 Influenza A
    102949289 (CHUK)
   05162 Measles
    102949289 (CHUK)
   05168 Herpes simplex virus 1 infection
    102949289 (CHUK)
   05163 Human cytomegalovirus infection
    102949289 (CHUK)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102949289 (CHUK)
   05169 Epstein-Barr virus infection
    102949289 (CHUK)
   05165 Human papillomavirus infection
    102949289 (CHUK)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102949289 (CHUK)
   05142 Chagas disease
    102949289 (CHUK)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    102949289 (CHUK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptg01001]
    102949289 (CHUK)
Enzymes [BR:ptg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     102949289 (CHUK)
Protein kinases [BR:ptg01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   102949289 (CHUK)
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr IKKbetaNEMObind Pkinase_fungal Kdo TBK1_ULD APH
Other DBs
NCBI-GeneID: 102949289
NCBI-ProteinID: XP_007080227
LinkDB
Position
Un
AA seq 677 aa
MKKLNHANVVKACDVPEELNFLINDVPLLAMEYCSGGDLRKLLNKPENCCGLKESQILSL
LSDIGSGIRYLHENKIIHRDLKPENIVLQDAGGKIMHKIIDLGYAKDVDQGSLCTSFVGT
LQYLAPELFENKPYTATVDYWSFGTMVFECIAGYRPFLHHLQPFTWHEKIKKKDPKCIFA
CEEMTGEVRFSSHLPQPNSLCSLIVEPMENWLQLMLNWDPQQRGGPVDLTLKQPRCFLLM
DHILNLKIVHILNMTSAKIISFLLPPDESLHSLQSRIERETGISTGSQELLSETGISLDP
RKPASQCVLDGVRGCDSYMVYLFDKSKTVYEGPFASRSLSDCVNYIVRDSKIQLPIIQLR
KVWAEAVHYVSGLKEDYSRLFQGQRAAMLSLLRYNANLTKMKNTLISASQQLKAKLEFFH
KSIQLDLERYSEQMTYGISSEKMLKAWKEMEEKAIHYAEVGVIGYLEDQIMSLHTEIMEL
QKSPYGRRQGDLMESLEQRAIDLYKQLKHRPSDHSYSDSTEMVKIIVHTVQSQDRVLKEL
FGHLSKLLGCKQKIIDLLPKVEMALSNIKEADNTVMFMQKEIWHLLKIACTQSSARSLVG
SSLEGAITPQASAWLPPTSAEREHPLSCVVTPQDGETVAQMIEENLNCLGHLSTIIHEAN
EEQGSSMMNLDWSWLTE
NT seq 2034 nt   +upstreamnt  +downstreamnt
atgaagaagttgaaccatgccaacgttgtaaaggcctgtgatgtacctgaggagttgaat
tttttaattaatgatgttcctcttctagcaatggaatactgttctggcggagatctccgg
aagctactcaacaaaccagaaaattgctgtgggcttaaagaaagccagatactttcttta
ctgagtgatatagggtctgggatccgatatttgcatgaaaacaaaatcatacatcgtgat
ctaaaacctgaaaacatagttcttcaggatgctggtggaaagattatgcataaaataatt
gatctgggatatgccaaagatgttgatcaaggaagtctgtgtacgtcttttgtgggaaca
ctgcaatatctggccccagagctctttgagaacaagccttatacagctactgttgattac
tggagctttgggaccatggtgtttgaatgtattgctggatataggccctttttgcatcat
ctgcagccatttacctggcatgagaagatcaagaagaaggatccaaagtgtatatttgca
tgtgaagagatgacaggagaagttcggtttagtagccatttacctcaaccaaatagcctt
tgtagtttaatagtagagcccatggaaaactggcttcagttgatgctgaattgggatcct
cagcaaagaggaggacctgttgatctcactttgaagcagccaagatgttttctattaatg
gatcacattctgaatttgaagatagtacacatcctaaatatgacttctgcaaagataatt
tcttttctgttaccacctgatgaaagtcttcactcactgcagtctcgtattgagcgcgaa
actggaataagtactggttctcaagagcttctttcggagacgggaatttctctggatcct
cggaaaccagcctctcagtgtgttctagatggagttagaggctgtgatagctatatggta
tatttgtttgataaaagtaagactgtatatgaaggaccatttgcttccagaagtttatct
gactgtgtaaattacattgtacgggacagcaaaatacaacttccaattatacagctacgt
aaagtatgggctgaagcagtgcattatgtgtctgggctaaaagaagactacagcaggctc
tttcagggacaaagagcagcaatgttaagtcttcttagatataatgcaaatctgacaaaa
atgaagaacactttgatctcagcatctcagcaactgaaagccaaattggagtttttccac
aaaagcattcaacttgacttggaaagatacagtgagcagatgacttacgggatatcctca
gaaaaaatgttaaaagcatggaaggaaatggaagaaaaggctatccactatgctgaggtg
ggtgtcattggttacctggaggatcagatcatgtccctgcatactgaaatcatggagctg
cagaagagcccttatggaagacgtcagggagacttgatggaatctctggaacagcgtgcc
attgatctgtataagcagttaaagcacagaccttcagatcactcctacagcgacagcaca
gaaatggtgaagatcattgtacatactgttcagagtcaggaccgggttctcaaggagctg
tttggtcatctgagcaagttattgggctgtaagcagaagattattgatctactgcccaag
gtggaaatggccctcagtaacatcaaagaagctgacaatactgtcatgtttatgcagaaa
gaaatatggcatctccttaaaattgcctgtacacagagttctgcccggtcccttgtagga
tccagtctagaaggtgcaataacgcctcaggcatcagcatggcttcccccaacttcagca
gaacgtgaacatcccctgtcatgcgtggtaactcctcaagatggggagactgtagcacaa
atgatagaagaaaatttgaactgtcttggccatttaagcactattattcatgaagcaaat
gaggaacagggcagtagtatgatgaatcttgattggagttggttaacagaatga

KEGG   Panthera tigris altaica (Amur tiger): 102963734
Entry
102963734         CDS       T02988                                 

Gene name
IKBKB
Definition
(RefSeq) inhibitor of nuclear factor kappa B kinase subunit beta
  KO
K07209  inhibitor of nuclear factor kappa-B kinase subunit beta [EC:2.7.11.10]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01523  Antifolate resistance
ptg04010  MAPK signaling pathway
ptg04014  Ras signaling pathway
ptg04062  Chemokine signaling pathway
ptg04064  NF-kappa B signaling pathway
ptg04068  FoxO signaling pathway
ptg04150  mTOR signaling pathway
ptg04151  PI3K-Akt signaling pathway
ptg04210  Apoptosis
ptg04380  Osteoclast differentiation
ptg04620  Toll-like receptor signaling pathway
ptg04621  NOD-like receptor signaling pathway
ptg04622  RIG-I-like receptor signaling pathway
ptg04623  Cytosolic DNA-sensing pathway
ptg04625  C-type lectin receptor signaling pathway
ptg04657  IL-17 signaling pathway
ptg04658  Th1 and Th2 cell differentiation
ptg04659  Th17 cell differentiation
ptg04660  T cell receptor signaling pathway
ptg04662  B cell receptor signaling pathway
ptg04668  TNF signaling pathway
ptg04722  Neurotrophin signaling pathway
ptg04910  Insulin signaling pathway
ptg04920  Adipocytokine signaling pathway
ptg04930  Type II diabetes mellitus
ptg04931  Insulin resistance
ptg04932  Non-alcoholic fatty liver disease
ptg05010  Alzheimer disease
ptg05132  Salmonella infection
ptg05135  Yersinia infection
ptg05142  Chagas disease
ptg05145  Toxoplasmosis
ptg05160  Hepatitis C
ptg05161  Hepatitis B
ptg05162  Measles
ptg05163  Human cytomegalovirus infection
ptg05164  Influenza A
ptg05165  Human papillomavirus infection
ptg05166  Human T-cell leukemia virus 1 infection
ptg05167  Kaposi sarcoma-associated herpesvirus infection
ptg05168  Herpes simplex virus 1 infection
ptg05169  Epstein-Barr virus infection
ptg05170  Human immunodeficiency virus 1 infection
ptg05171  Coronavirus disease - COVID-19
ptg05200  Pathways in cancer
ptg05206  MicroRNAs in cancer
ptg05212  Pancreatic cancer
ptg05215  Prostate cancer
ptg05220  Chronic myeloid leukemia
ptg05221  Acute myeloid leukemia
ptg05222  Small cell lung cancer
ptg05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ptg05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102963734 (IKBKB)
   04014 Ras signaling pathway
    102963734 (IKBKB)
   04064 NF-kappa B signaling pathway
    102963734 (IKBKB)
   04668 TNF signaling pathway
    102963734 (IKBKB)
   04068 FoxO signaling pathway
    102963734 (IKBKB)
   04151 PI3K-Akt signaling pathway
    102963734 (IKBKB)
   04150 mTOR signaling pathway
    102963734 (IKBKB)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102963734 (IKBKB)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102963734 (IKBKB)
   04621 NOD-like receptor signaling pathway
    102963734 (IKBKB)
   04622 RIG-I-like receptor signaling pathway
    102963734 (IKBKB)
   04623 Cytosolic DNA-sensing pathway
    102963734 (IKBKB)
   04625 C-type lectin receptor signaling pathway
    102963734 (IKBKB)
   04660 T cell receptor signaling pathway
    102963734 (IKBKB)
   04658 Th1 and Th2 cell differentiation
    102963734 (IKBKB)
   04659 Th17 cell differentiation
    102963734 (IKBKB)
   04657 IL-17 signaling pathway
    102963734 (IKBKB)
   04662 B cell receptor signaling pathway
    102963734 (IKBKB)
   04062 Chemokine signaling pathway
    102963734 (IKBKB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102963734 (IKBKB)
   04920 Adipocytokine signaling pathway
    102963734 (IKBKB)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102963734 (IKBKB)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102963734 (IKBKB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102963734 (IKBKB)
   05206 MicroRNAs in cancer
    102963734 (IKBKB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102963734 (IKBKB)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102963734 (IKBKB)
   05221 Acute myeloid leukemia
    102963734 (IKBKB)
   05220 Chronic myeloid leukemia
    102963734 (IKBKB)
   05215 Prostate cancer
    102963734 (IKBKB)
   05222 Small cell lung cancer
    102963734 (IKBKB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102963734 (IKBKB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102963734 (IKBKB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102963734 (IKBKB)
   04932 Non-alcoholic fatty liver disease
    102963734 (IKBKB)
   04931 Insulin resistance
    102963734 (IKBKB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102963734 (IKBKB)
   05135 Yersinia infection
    102963734 (IKBKB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102963734 (IKBKB)
   05170 Human immunodeficiency virus 1 infection
    102963734 (IKBKB)
   05161 Hepatitis B
    102963734 (IKBKB)
   05160 Hepatitis C
    102963734 (IKBKB)
   05171 Coronavirus disease - COVID-19
    102963734 (IKBKB)
   05164 Influenza A
    102963734 (IKBKB)
   05162 Measles
    102963734 (IKBKB)
   05168 Herpes simplex virus 1 infection
    102963734 (IKBKB)
   05163 Human cytomegalovirus infection
    102963734 (IKBKB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102963734 (IKBKB)
   05169 Epstein-Barr virus infection
    102963734 (IKBKB)
   05165 Human papillomavirus infection
    102963734 (IKBKB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102963734 (IKBKB)
   05142 Chagas disease
    102963734 (IKBKB)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    102963734 (IKBKB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptg01001]
    102963734 (IKBKB)
Enzymes [BR:ptg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     102963734 (IKBKB)
Protein kinases [BR:ptg01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   102963734 (IKBKB)
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr IKKbetaNEMObind Pkinase_fungal Kdo ubiquitin APH YrbL-PhoP_reg Med20 Glyco_hydro_65m
Other DBs
NCBI-GeneID: 102963734
NCBI-ProteinID: XP_007097098
LinkDB
Position
Un
AA seq 760 aa
MSWSPSLPTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCL
EIQIMRRLNHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREG
AILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCT
SFVGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQWHSKVRQKSE
MDIVVSEDLNGAVKFSSSLPYPNNLNSVLAQRLEKWLQLMLMWHPRQRGTDPVYGPNGCF
KALDDILNLKLVHILNMVTGIIHTYPVTEDESLQSLKARIQNDTGIPEEDQELLQEAGLA
LIPDKPATQCISEGKLNEGRTLDMDLVFLFDNSKITYETQISPRPQPESVSCILQEPKRN
LSFFQLRKVWGQVWHSIQTLKEDCNRLQQGQRAAMMNLLRNNSCLSKMKNSMASMSQQLK
AKLDFFKTSIQIDLEKYSEQTEFGITSDKLLLAWREMEQAVELCGRLFHQENEVKHLVER
MMALQTDIVDLQRSPMGRKQGGTLDDLEEQARELYRRLREKPRDQRTDGDSLEMVRLLLQ
AIQGFEKKVRVIYTQLSKTVVCKQKALELLPKVEEVVSLMNEDEKTVVRLQEKRQKELWN
LLKIACSKVRGPVSGSPDSMNAARLSHSGQLMSQPSTAPNSLPESVKKSEELVAEAHTLC
TQLENVMQDTIKEQDQSLRSLDWSWLQTEEEEQNGLEQAS
NT seq 2283 nt   +upstreamnt  +downstreamnt
atgagctggtcaccttcgctgccaacccagacatgtggggcctgggagatgaaagaacga
cttgggacagggggatttggaaacgtcattcgatggcacaatcaggaaacaggtgagcag
attgctatcaagcagtgccggcaggagctcagcccccggaatcgagagcggtggtgcctg
gagatccagatcatgagaaggctgaaccaccccaatgtggtagctgcccgggatgtccct
gaggggatgcagaacttggctcccaatgacttgcctctgctggccatggagtactgccaa
ggaggagatctccgaaagtacctgaaccagtttgagaactgctgtggcctgcgggaagga
gccatcctcaccttgctgagtgacattgcctctgcacttagataccttcatgaaaacaga
atcatccatcgggatctgaaaccagaaaacattgtcctgcagcaaggagaacaaagatta
atacacaaaattattgacctaggatatgccaaggaactggatcagggcagtctctgtact
tcctttgtggggaccctgcaatacctggccccggaactcctcgagcagcagaagtacaca
gtgactgtggactactggagcttcggcaccttggcttttgagtgcatcacaggtttccga
cctttcctccctaactggcagcccgtgcagtggcattccaaagtccggcagaagagtgag
atggacattgttgtcagtgaagacttgaatggagcggtgaagttttctagctccttaccc
tatcccaataatctgaacagcgtcctggcacagcgacttgagaagtggctgcagctgatg
ctgatgtggcacccacgacagaggggcaccgatcccgtgtatggtcccaatggctgtttc
aaggccctggatgacatcttaaacctaaagctggttcatatcttgaacatggtcacaggc
atcattcacacgtatccagtgacagaggatgagagtctgcagagcttaaaggccagaatc
cagaatgacacagggatccccgaggaggaccaggagctgctgcaagaagctggtctggca
ttgatccctgacaagccggctactcagtgtatttcagagggcaagctgaatgagggccgc
acattggacatggatctcgtctttctctttgacaacagtaaaatcacgtatgagactcag
atctcgccacggccccaacctgaaagtgtcagctgtatccttcaagagcccaagaggaac
ctctccttcttccagctgaggaaagtgtggggccaggtttggcacagcatccagaccctg
aaggaggactgtaaccggctacagcagggacagcgagctgccatgatgaatctcctccgg
aataatagctgcctctccaagatgaagaattctatggcttccatgtctcagcagctcaaa
gccaagttggatttctttaaaaccagcatccagattgacctggagaagtacagtgagcag
acagagtttgggatcacatcagataaactgctgctggcctggagggaaatggaacaggct
gtggagctctgtgggcggctttttcatcaggagaatgaagtgaagcacctggtggagcgg
atgatggcactgcagactgacattgtggacctgcagaggagccccatggggcggaagcag
gggggaacgctggacgacctagaagagcaagcgagggagctttacaggagacttcgggaa
aaacccagagaccaacgaactgatggtgacagtcttgaaatggtccggctgcttcttcag
gccatccaaggctttgagaagaaagtgcgagtgatttatacgcagctcagtaaaactgtg
gtttgcaagcagaaggctctggaactgttgcccaaggtggaagaggtggtgagtttaatg
aacgaagacgagaagactgttgtccggcttcaggagaagcggcagaaggagctctggaat
ctcctgaagattgcttgtagcaaagttcgtggtcctgtgagtggaagcccagatagcatg
aatgctgctcgcctcagtcattctggtcagctaatgtctcagccttccactgcccctaac
agcttgcctgagtctgtcaagaaaagtgaagaactggtggctgaagcacacacgctctgc
acccagctagaaaatgtgatgcaagataccatcaaagagcaggaccagagtttaaggtct
ctagactggagctggttacagacggaagaagaagagcagaatggcctggaacaggcctct
tga

DBGET integrated database retrieval system