KEGG   Panthera tigris altaica (Amur tiger): 102949359
Entry
102949359         CDS       T02988                                 

Gene name
PPP3CC
Definition
(RefSeq) protein phosphatase 3 catalytic subunit gamma
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04010  MAPK signaling pathway
ptg04020  Calcium signaling pathway
ptg04022  cGMP-PKG signaling pathway
ptg04114  Oocyte meiosis
ptg04218  Cellular senescence
ptg04310  Wnt signaling pathway
ptg04360  Axon guidance
ptg04370  VEGF signaling pathway
ptg04380  Osteoclast differentiation
ptg04625  C-type lectin receptor signaling pathway
ptg04650  Natural killer cell mediated cytotoxicity
ptg04658  Th1 and Th2 cell differentiation
ptg04659  Th17 cell differentiation
ptg04660  T cell receptor signaling pathway
ptg04662  B cell receptor signaling pathway
ptg04720  Long-term potentiation
ptg04724  Glutamatergic synapse
ptg04728  Dopaminergic synapse
ptg04921  Oxytocin signaling pathway
ptg04922  Glucagon signaling pathway
ptg04924  Renin secretion
ptg05010  Alzheimer disease
ptg05014  Amyotrophic lateral sclerosis
ptg05020  Prion disease
ptg05022  Pathways of neurodegeneration - multiple diseases
ptg05031  Amphetamine addiction
ptg05152  Tuberculosis
ptg05163  Human cytomegalovirus infection
ptg05166  Human T-cell leukemia virus 1 infection
ptg05167  Kaposi sarcoma-associated herpesvirus infection
ptg05170  Human immunodeficiency virus 1 infection
ptg05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102949359 (PPP3CC)
   04310 Wnt signaling pathway
    102949359 (PPP3CC)
   04370 VEGF signaling pathway
    102949359 (PPP3CC)
   04020 Calcium signaling pathway
    102949359 (PPP3CC)
   04022 cGMP-PKG signaling pathway
    102949359 (PPP3CC)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102949359 (PPP3CC)
   04218 Cellular senescence
    102949359 (PPP3CC)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102949359 (PPP3CC)
   04650 Natural killer cell mediated cytotoxicity
    102949359 (PPP3CC)
   04660 T cell receptor signaling pathway
    102949359 (PPP3CC)
   04658 Th1 and Th2 cell differentiation
    102949359 (PPP3CC)
   04659 Th17 cell differentiation
    102949359 (PPP3CC)
   04662 B cell receptor signaling pathway
    102949359 (PPP3CC)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    102949359 (PPP3CC)
   04921 Oxytocin signaling pathway
    102949359 (PPP3CC)
   04924 Renin secretion
    102949359 (PPP3CC)
  09156 Nervous system
   04724 Glutamatergic synapse
    102949359 (PPP3CC)
   04728 Dopaminergic synapse
    102949359 (PPP3CC)
   04720 Long-term potentiation
    102949359 (PPP3CC)
  09158 Development and regeneration
   04360 Axon guidance
    102949359 (PPP3CC)
   04380 Osteoclast differentiation
    102949359 (PPP3CC)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102949359 (PPP3CC)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102949359 (PPP3CC)
   05014 Amyotrophic lateral sclerosis
    102949359 (PPP3CC)
   05020 Prion disease
    102949359 (PPP3CC)
   05022 Pathways of neurodegeneration - multiple diseases
    102949359 (PPP3CC)
  09165 Substance dependence
   05031 Amphetamine addiction
    102949359 (PPP3CC)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102949359 (PPP3CC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102949359 (PPP3CC)
   05170 Human immunodeficiency virus 1 infection
    102949359 (PPP3CC)
   05163 Human cytomegalovirus infection
    102949359 (PPP3CC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102949359 (PPP3CC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ptg01009]
    102949359 (PPP3CC)
Enzymes [BR:ptg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     102949359 (PPP3CC)
Protein phosphatases and associated proteins [BR:ptg01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     102949359 (PPP3CC)
SSDB
Motif
Pfam: Metallophos DUF5378 PTEN_C2
Other DBs
NCBI-GeneID: 102949359
NCBI-ProteinID: XP_015398273
LinkDB
Position
Un
AA seq 532 aa
MSGRNFHLSTTERVIKAVPFPPTQRLTLKEVFENGKPKIDVLRNHLVKEGRLEEEVALKI
INDGAAILRQEKTMIELDSPITVCGDIHGQFFDLMKLFEVGGSPTNTRYLFLGDYVDRGY
FSIECVLFLWSLKINHPKTVFLLRGNHECRHLTEYFTFKQECRIKYSEQVYDACMETFDC
LPLAALLNQQFLCVHGGMSPEITSLDDIRKLDRFKEPPAFGPVCDLLWSDPSEDYGSEKT
LEHYTHNTVRGCSYFYSYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLIT
IFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEM
LVNVLNICSDDELISEDEIEDHYISSYRKGGTTVRKEIIKNKIRAIGKMARVFSILREES
ESVLTLKGLTPTGTLPLGVLSGGKQTIETATVEAVEAREAIRGFSLQHRIRSFEEARGLD
RINERMPPRKDSQYPDGPVRLPAQPSAAHRSDRGRRANNDTEPCCGTGGSKT
NT seq 1599 nt   +upstreamnt  +downstreamnt
atgtctgggaggaacttccacctctccaccaccgaacgcgtcatcaaagctgtccccttt
cctccaacccaacggcttactttgaaggaagtatttgagaatgggaaacctaaaattgat
gtcttaagaaaccatttggtgaaggaagggcgactggaagaggaagtagccttaaagata
atcaatgatggggctgctatcctgagacaagagaagactatgatagaactagattctcca
atcacagtgtgtggtgacattcatggacaattctttgacttgatgaagttgttcgaagtt
ggaggatcacctactaacacacgctacctctttctgggtgactatgtggacagaggctat
ttcagtatagagtgtgtgctgtttttgtggagtttaaagattaatcatcccaaaacagtg
tttctgcttcgaggaaatcatgagtgcaggcatcttacagaatatttcaccttcaaacag
gaatgtcgaatcaaatattctgaacaggtgtatgatgcgtgtatggagacatttgactgt
cttccacttgctgccctcttaaaccagcagtttctgtgtgtacatggagggatgtcacct
gaaattactagtttagatgacattaggaaattagacaggtttaaagaacctccagccttt
gggccagtgtgtgacctgctttggtctgatccctcagaggattatggcagtgaaaagacc
ttggagcactatacccacaacactgtccgagggtgctcttatttttacagttaccctgca
gtttgtgaatttttgcagaacaataatttgttatcaataatcagagcccatgaagcccaa
gatgctgggtatcgaatgtacaggaagagccaaacaacaggctttccatcactcattaca
attttctctgcccccaattacctagatgtctataacaataaagctgctgtgttaaaatat
gaaaacaatgtcatgaatatcaggcagtttaactgttctccacacccctactggcttcca
aactttatggatgttttcacgtggtctttgccttttgttggggaaaaagtcacagagatg
ctggttaatgttctcaacatatgctctgatgatgaattgatttccgaagatgaaattgaa
gatcactacatttcaagctatcggaaaggaggcactacagttcgaaaggagatcatcaag
aataaaatcagagccattgggaagatggcacgggtcttttcaattctgcgggaagagagt
gagagtgtgctgactctcaagggcctgacgcctacagggacactccctctaggtgtcctc
tcaggaggaaagcagactattgagacagccacagtagaagcggtagaggcccgggaagcc
atcagagggttttcgcttcagcaccggatccggagttttgaagaagcccgaggactggac
cgaattaacgaacggatgccacctcgaaaagacagccagtaccctgacgggccagtgaga
ctgccggcacagcccagcgctgcgcacaggagcgacagggggagaagagccaacaatgac
acagagccctgctgtggcacaggtggatcgaaaacttaa

KEGG   Panthera tigris altaica (Amur tiger): 102952632
Entry
102952632         CDS       T02988                                 

Gene name
PPP3CA
Definition
(RefSeq) protein phosphatase 3 catalytic subunit alpha
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04010  MAPK signaling pathway
ptg04020  Calcium signaling pathway
ptg04022  cGMP-PKG signaling pathway
ptg04114  Oocyte meiosis
ptg04218  Cellular senescence
ptg04310  Wnt signaling pathway
ptg04360  Axon guidance
ptg04370  VEGF signaling pathway
ptg04380  Osteoclast differentiation
ptg04625  C-type lectin receptor signaling pathway
ptg04650  Natural killer cell mediated cytotoxicity
ptg04658  Th1 and Th2 cell differentiation
ptg04659  Th17 cell differentiation
ptg04660  T cell receptor signaling pathway
ptg04662  B cell receptor signaling pathway
ptg04720  Long-term potentiation
ptg04724  Glutamatergic synapse
ptg04728  Dopaminergic synapse
ptg04921  Oxytocin signaling pathway
ptg04922  Glucagon signaling pathway
ptg04924  Renin secretion
ptg05010  Alzheimer disease
ptg05014  Amyotrophic lateral sclerosis
ptg05020  Prion disease
ptg05022  Pathways of neurodegeneration - multiple diseases
ptg05031  Amphetamine addiction
ptg05152  Tuberculosis
ptg05163  Human cytomegalovirus infection
ptg05166  Human T-cell leukemia virus 1 infection
ptg05167  Kaposi sarcoma-associated herpesvirus infection
ptg05170  Human immunodeficiency virus 1 infection
ptg05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102952632 (PPP3CA)
   04310 Wnt signaling pathway
    102952632 (PPP3CA)
   04370 VEGF signaling pathway
    102952632 (PPP3CA)
   04020 Calcium signaling pathway
    102952632 (PPP3CA)
   04022 cGMP-PKG signaling pathway
    102952632 (PPP3CA)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102952632 (PPP3CA)
   04218 Cellular senescence
    102952632 (PPP3CA)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102952632 (PPP3CA)
   04650 Natural killer cell mediated cytotoxicity
    102952632 (PPP3CA)
   04660 T cell receptor signaling pathway
    102952632 (PPP3CA)
   04658 Th1 and Th2 cell differentiation
    102952632 (PPP3CA)
   04659 Th17 cell differentiation
    102952632 (PPP3CA)
   04662 B cell receptor signaling pathway
    102952632 (PPP3CA)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    102952632 (PPP3CA)
   04921 Oxytocin signaling pathway
    102952632 (PPP3CA)
   04924 Renin secretion
    102952632 (PPP3CA)
  09156 Nervous system
   04724 Glutamatergic synapse
    102952632 (PPP3CA)
   04728 Dopaminergic synapse
    102952632 (PPP3CA)
   04720 Long-term potentiation
    102952632 (PPP3CA)
  09158 Development and regeneration
   04360 Axon guidance
    102952632 (PPP3CA)
   04380 Osteoclast differentiation
    102952632 (PPP3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102952632 (PPP3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102952632 (PPP3CA)
   05014 Amyotrophic lateral sclerosis
    102952632 (PPP3CA)
   05020 Prion disease
    102952632 (PPP3CA)
   05022 Pathways of neurodegeneration - multiple diseases
    102952632 (PPP3CA)
  09165 Substance dependence
   05031 Amphetamine addiction
    102952632 (PPP3CA)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102952632 (PPP3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102952632 (PPP3CA)
   05170 Human immunodeficiency virus 1 infection
    102952632 (PPP3CA)
   05163 Human cytomegalovirus infection
    102952632 (PPP3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102952632 (PPP3CA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ptg01009]
    102952632 (PPP3CA)
Enzymes [BR:ptg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     102952632 (PPP3CA)
Protein phosphatases and associated proteins [BR:ptg01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     102952632 (PPP3CA)
SSDB
Motif
Pfam: Metallophos SMRP1
Other DBs
NCBI-GeneID: 102952632
NCBI-ProteinID: XP_015392511
LinkDB
Position
Un
AA seq 591 aa
MKALVMLAGKMIFQLRFHHSCRESPCHGRSYCPRSLYMCCANEPCPRSLERHLDQEKAYS
SSQFGPGGFHAFSGHMLLVNWTEQIYRLSAVPFPPSHRLTAKEVFDNDGKPRVDILKAHL
MKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPAN
TRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKY
SERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDI
LWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRM
YRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVF
TWSLPFVGEKVTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVF
SVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSF
EEAKGLDRINERMPPRRDAMPSDANLNSINKALASETNGTDSNGSNSSNIQ
NT seq 1776 nt   +upstreamnt  +downstreamnt
atgaaggcgctggtgatgttggcgggcaagatgatcttccagctccgttttcaccactcc
tgcagagagtcaccttgccatggcaggagctactgtccaaggtctctgtatatgtgctgc
gcaaacgagccttgcccaaggtctttggagagacatttagatcaggaaaaggcgtacagc
tcatctcagtttggaccaggtggttttcacgcgttcagcggccatatgttgctggtcaat
tggacagaacagatttacaggctttcagctgtcccatttcctccaagtcaccgacttaca
gcaaaagaagtattcgataatgatgggaagcctcgtgtggatatcttaaaggcacatctc
atgaaggagggcaggctggaagagagcgttgcattgagaataataacagagggggcctca
attcttcgacaggaaaaaaatttgctggatatcgatgcaccagtcacagtttgtggggac
atccatggacaattctttgatttgatgaagctttttgaagtggggggatctcctgccaac
actcgctacctcttcttaggggactatgttgacagagggtacttcagtattgaatgtgtg
ctgtatttgtgggccttgaaaattctttaccccaaaacactgtttttacttcgtggaaat
catgaatgtagacatctaacagagtatttcacatttaaacaagaatgtaaaataaagtat
tcagaacgcgtatatgatgcctgtatggatgcctttgactgcctgcccctggctgccctg
atgaaccaacagttcctgtgtgtacacggtggtttgtctccagagattaacactttagat
gatatcagaaaattagaccgattcaaagaaccacctgcttacggacctatgtgtgatatc
ctgtggtcagaccccctggaggattttggaaatgagaagactcaggaacatttcactcac
aacacagtcagggggtgttcgtacttctacagctacccggctgtatgtgaattcttacag
cacaataacctgttgtctatactccgagcccatgaagcccaagatgcagggtatcgcatg
tacaggaaaagccaaacgacaggcttcccttctctaattacaattttttcagcaccaaat
tacttagatgtgtacaataacaaagctgcagtattgaagtatgagaacaatgtcatgaac
atcaggcaattcaactgttctcctcacccatactggcttccaaatttcatggatgttttc
acttggtccctgccctttgttggggaaaaagtgactgaaatgctggtaaatgtcctcaac
atctgctcagatgatgaactagggtcagaagaagatggatttgatggcgcaacagctgca
gcccggaaggaggtgataaggaacaagatccgagcaataggcaaaatggcccgagtgttc
tcagttctcagagaagagagtgagagcgtgctaacgctgaaaggcttgactcccacgggc
atgctccccagcggagtgctttctggagggaagcagaccctgcaaagcgctactgttgag
gctattgaggctgatgaagccatcaaaggattttcaccacaacataagatcactagcttc
gaggaggccaagggcttagaccgaattaacgagaggatgccacctcgcagagatgccatg
ccctctgacgccaaccttaactccatcaacaaggctctcgcctcagagactaacggcacg
gacagcaatggcagtaatagcagcaatatccagtga

KEGG   Panthera tigris altaica (Amur tiger): 102963447
Entry
102963447         CDS       T02988                                 

Gene name
PPP3CB
Definition
(RefSeq) protein phosphatase 3 catalytic subunit beta
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04010  MAPK signaling pathway
ptg04020  Calcium signaling pathway
ptg04022  cGMP-PKG signaling pathway
ptg04114  Oocyte meiosis
ptg04218  Cellular senescence
ptg04310  Wnt signaling pathway
ptg04360  Axon guidance
ptg04370  VEGF signaling pathway
ptg04380  Osteoclast differentiation
ptg04625  C-type lectin receptor signaling pathway
ptg04650  Natural killer cell mediated cytotoxicity
ptg04658  Th1 and Th2 cell differentiation
ptg04659  Th17 cell differentiation
ptg04660  T cell receptor signaling pathway
ptg04662  B cell receptor signaling pathway
ptg04720  Long-term potentiation
ptg04724  Glutamatergic synapse
ptg04728  Dopaminergic synapse
ptg04921  Oxytocin signaling pathway
ptg04922  Glucagon signaling pathway
ptg04924  Renin secretion
ptg05010  Alzheimer disease
ptg05014  Amyotrophic lateral sclerosis
ptg05020  Prion disease
ptg05022  Pathways of neurodegeneration - multiple diseases
ptg05031  Amphetamine addiction
ptg05152  Tuberculosis
ptg05163  Human cytomegalovirus infection
ptg05166  Human T-cell leukemia virus 1 infection
ptg05167  Kaposi sarcoma-associated herpesvirus infection
ptg05170  Human immunodeficiency virus 1 infection
ptg05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102963447 (PPP3CB)
   04310 Wnt signaling pathway
    102963447 (PPP3CB)
   04370 VEGF signaling pathway
    102963447 (PPP3CB)
   04020 Calcium signaling pathway
    102963447 (PPP3CB)
   04022 cGMP-PKG signaling pathway
    102963447 (PPP3CB)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102963447 (PPP3CB)
   04218 Cellular senescence
    102963447 (PPP3CB)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102963447 (PPP3CB)
   04650 Natural killer cell mediated cytotoxicity
    102963447 (PPP3CB)
   04660 T cell receptor signaling pathway
    102963447 (PPP3CB)
   04658 Th1 and Th2 cell differentiation
    102963447 (PPP3CB)
   04659 Th17 cell differentiation
    102963447 (PPP3CB)
   04662 B cell receptor signaling pathway
    102963447 (PPP3CB)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    102963447 (PPP3CB)
   04921 Oxytocin signaling pathway
    102963447 (PPP3CB)
   04924 Renin secretion
    102963447 (PPP3CB)
  09156 Nervous system
   04724 Glutamatergic synapse
    102963447 (PPP3CB)
   04728 Dopaminergic synapse
    102963447 (PPP3CB)
   04720 Long-term potentiation
    102963447 (PPP3CB)
  09158 Development and regeneration
   04360 Axon guidance
    102963447 (PPP3CB)
   04380 Osteoclast differentiation
    102963447 (PPP3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102963447 (PPP3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102963447 (PPP3CB)
   05014 Amyotrophic lateral sclerosis
    102963447 (PPP3CB)
   05020 Prion disease
    102963447 (PPP3CB)
   05022 Pathways of neurodegeneration - multiple diseases
    102963447 (PPP3CB)
  09165 Substance dependence
   05031 Amphetamine addiction
    102963447 (PPP3CB)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102963447 (PPP3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102963447 (PPP3CB)
   05170 Human immunodeficiency virus 1 infection
    102963447 (PPP3CB)
   05163 Human cytomegalovirus infection
    102963447 (PPP3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102963447 (PPP3CB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ptg01009]
    102963447 (PPP3CB)
Enzymes [BR:ptg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     102963447 (PPP3CB)
Protein phosphatases and associated proteins [BR:ptg01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     102963447 (PPP3CB)
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 102963447
NCBI-ProteinID: XP_007095742
LinkDB
Position
Un
AA seq 447 aa
MIEVEAPITVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWVLK
ILYPSTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYEACMEAFDSLPLAALLNQQFLC
VHGGLSPEIHTLDDIRRLDRFKEPPAFGPMCDLLWSDPSEDFGNEKSQEHFSHNTVRGCS
YFYNYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNN
KAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDEL
MTEGEDQFDERLIYGNKKGSAAARKEIIRNKIRAIGKMARVFSVLREESESVLTLKGLTP
TGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRICSFEEAKGLDRINERMPPRKD
AVQQDGFNSLNTAHATENHGTGNHSAQ
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgatagaagtagaggctccaattacagtgtgtggtgacatccatggccaattttttgat
ctgatgaaactttttgaagtaggaggatcacctgctaatacacgatacctttttcttggt
gattatgtggacagaggttattttagtatagagtgtgtcttatatttatgggtcctgaag
attctttacccaagcacattatttcttctgagaggcaatcatgaatgcagacaccttact
gaatattttacctttaagcaggaatgtaaaattaaatattcagaaagagtctatgaagct
tgtatggaagcttttgatagcctgcctcttgctgcacttttaaatcaacaatttctttgt
gttcatggtggactttcaccagaaatacacacactggatgatattaggagattagataga
ttcaaagagccacctgcatttggaccaatgtgtgacttgctatggtccgatccttctgaa
gattttggaaatgaaaaatcacaggaacattttagtcacaatacagttcgaggatgttct
tatttttataactatccagcagtgtgtgaatttttgcaaaacaataatttgttatcgatt
attagagctcatgaagctcaagatgcaggctatagaatgtacagaaaaagtcaaactaca
gggttcccttcattaataacaattttttcggcacctaattacttagatgtctacaataat
aaagctgctgtattaaagtatgaaaataatgtgatgaatattcgacaatttaactgttct
ccacatccttactggttgcccaattttatggatgtcttcacatggtctttaccatttgtt
ggagaaaaagtgacagaaatgttggtaaatgttctgagtatttgctctgatgatgaactg
atgactgaaggtgaagaccagtttgatgaacggctcatatatggcaataaaaaaggttca
gctgcagcccggaaagaaatcataagaaacaaaattcgagcaattggcaagatggcaagg
gtcttctctgttctcagggaggagagtgaaagcgtgctgacactcaagggcctgactccc
acagggatgttgcctagtggagtgttggctggaggacgacagaccctgcaaagtgccaca
gttgaggctattgaggctgaaaaagcaatacgaggattctctccaccacatagaatctgc
agttttgaagaggcaaagggtttggataggatcaatgagagaatgccaccccggaaagat
gctgtacagcaagatggtttcaattctctgaacaccgcacatgccactgagaaccacggg
actggcaaccatagtgcccagtga

KEGG   Panthera tigris altaica (Amur tiger): 102965200
Entry
102965200         CDS       T02988                                 

Gene name
PPP3R1
Definition
(RefSeq) protein phosphatase 3 regulatory subunit B, alpha
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04010  MAPK signaling pathway
ptg04020  Calcium signaling pathway
ptg04022  cGMP-PKG signaling pathway
ptg04114  Oocyte meiosis
ptg04218  Cellular senescence
ptg04310  Wnt signaling pathway
ptg04360  Axon guidance
ptg04370  VEGF signaling pathway
ptg04380  Osteoclast differentiation
ptg04625  C-type lectin receptor signaling pathway
ptg04650  Natural killer cell mediated cytotoxicity
ptg04658  Th1 and Th2 cell differentiation
ptg04659  Th17 cell differentiation
ptg04660  T cell receptor signaling pathway
ptg04662  B cell receptor signaling pathway
ptg04720  Long-term potentiation
ptg04724  Glutamatergic synapse
ptg04921  Oxytocin signaling pathway
ptg04922  Glucagon signaling pathway
ptg04924  Renin secretion
ptg05010  Alzheimer disease
ptg05014  Amyotrophic lateral sclerosis
ptg05020  Prion disease
ptg05022  Pathways of neurodegeneration - multiple diseases
ptg05031  Amphetamine addiction
ptg05152  Tuberculosis
ptg05163  Human cytomegalovirus infection
ptg05166  Human T-cell leukemia virus 1 infection
ptg05167  Kaposi sarcoma-associated herpesvirus infection
ptg05170  Human immunodeficiency virus 1 infection
ptg05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102965200 (PPP3R1)
   04310 Wnt signaling pathway
    102965200 (PPP3R1)
   04370 VEGF signaling pathway
    102965200 (PPP3R1)
   04020 Calcium signaling pathway
    102965200 (PPP3R1)
   04022 cGMP-PKG signaling pathway
    102965200 (PPP3R1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102965200 (PPP3R1)
   04218 Cellular senescence
    102965200 (PPP3R1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102965200 (PPP3R1)
   04650 Natural killer cell mediated cytotoxicity
    102965200 (PPP3R1)
   04660 T cell receptor signaling pathway
    102965200 (PPP3R1)
   04658 Th1 and Th2 cell differentiation
    102965200 (PPP3R1)
   04659 Th17 cell differentiation
    102965200 (PPP3R1)
   04662 B cell receptor signaling pathway
    102965200 (PPP3R1)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    102965200 (PPP3R1)
   04921 Oxytocin signaling pathway
    102965200 (PPP3R1)
   04924 Renin secretion
    102965200 (PPP3R1)
  09156 Nervous system
   04724 Glutamatergic synapse
    102965200 (PPP3R1)
   04720 Long-term potentiation
    102965200 (PPP3R1)
  09158 Development and regeneration
   04360 Axon guidance
    102965200 (PPP3R1)
   04380 Osteoclast differentiation
    102965200 (PPP3R1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102965200 (PPP3R1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102965200 (PPP3R1)
   05014 Amyotrophic lateral sclerosis
    102965200 (PPP3R1)
   05020 Prion disease
    102965200 (PPP3R1)
   05022 Pathways of neurodegeneration - multiple diseases
    102965200 (PPP3R1)
  09165 Substance dependence
   05031 Amphetamine addiction
    102965200 (PPP3R1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102965200 (PPP3R1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102965200 (PPP3R1)
   05170 Human immunodeficiency virus 1 infection
    102965200 (PPP3R1)
   05163 Human cytomegalovirus infection
    102965200 (PPP3R1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102965200 (PPP3R1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ptg01009]
    102965200 (PPP3R1)
Protein phosphatases and associated proteins [BR:ptg01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     102965200 (PPP3R1)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Other DBs
NCBI-GeneID: 102965200
NCBI-ProteinID: XP_015393515
LinkDB
Position
Un
AA seq 160 aa
MCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEV
DFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQ
QIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
NT seq 483 nt   +upstreamnt  +downstreamnt
atgtgctcacactttgatgctgatgaaattaaaaggctaggaaagagatttaagaagctc
gatttggacaattctggttctttgagtgtggaagagttcatgtctctgcctgagttacaa
cagaatcctttagtacagcgagtaatagatatatttgacacagatgggaatggagaagta
gactttaaagaattcattgagggagtctctcagttcagtgtcaaaggagataaggaacag
aagttgaggtttgctttccgtatctatgacatggataaagatggctatatttccaacggg
gaactcttccaggtgctgaagatgatggtggggaacaatctgaaagatacacagttacag
caaattgtagacaaaaccataataaatgcagataaggatggagatggaagaatatccttc
gaagaattctgtgctgttgtaggtggcctagatatccacaaaaagatggtggtagatgtg
tga

KEGG   Panthera tigris altaica (Amur tiger): 102967427
Entry
102967427         CDS       T02988                                 

Gene name
PPP3R2
Definition
(RefSeq) protein phosphatase 3 regulatory subunit B, beta
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04010  MAPK signaling pathway
ptg04020  Calcium signaling pathway
ptg04022  cGMP-PKG signaling pathway
ptg04114  Oocyte meiosis
ptg04218  Cellular senescence
ptg04310  Wnt signaling pathway
ptg04360  Axon guidance
ptg04370  VEGF signaling pathway
ptg04380  Osteoclast differentiation
ptg04625  C-type lectin receptor signaling pathway
ptg04650  Natural killer cell mediated cytotoxicity
ptg04658  Th1 and Th2 cell differentiation
ptg04659  Th17 cell differentiation
ptg04660  T cell receptor signaling pathway
ptg04662  B cell receptor signaling pathway
ptg04720  Long-term potentiation
ptg04724  Glutamatergic synapse
ptg04921  Oxytocin signaling pathway
ptg04922  Glucagon signaling pathway
ptg04924  Renin secretion
ptg05010  Alzheimer disease
ptg05014  Amyotrophic lateral sclerosis
ptg05020  Prion disease
ptg05022  Pathways of neurodegeneration - multiple diseases
ptg05031  Amphetamine addiction
ptg05152  Tuberculosis
ptg05163  Human cytomegalovirus infection
ptg05166  Human T-cell leukemia virus 1 infection
ptg05167  Kaposi sarcoma-associated herpesvirus infection
ptg05170  Human immunodeficiency virus 1 infection
ptg05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102967427 (PPP3R2)
   04310 Wnt signaling pathway
    102967427 (PPP3R2)
   04370 VEGF signaling pathway
    102967427 (PPP3R2)
   04020 Calcium signaling pathway
    102967427 (PPP3R2)
   04022 cGMP-PKG signaling pathway
    102967427 (PPP3R2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102967427 (PPP3R2)
   04218 Cellular senescence
    102967427 (PPP3R2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102967427 (PPP3R2)
   04650 Natural killer cell mediated cytotoxicity
    102967427 (PPP3R2)
   04660 T cell receptor signaling pathway
    102967427 (PPP3R2)
   04658 Th1 and Th2 cell differentiation
    102967427 (PPP3R2)
   04659 Th17 cell differentiation
    102967427 (PPP3R2)
   04662 B cell receptor signaling pathway
    102967427 (PPP3R2)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    102967427 (PPP3R2)
   04921 Oxytocin signaling pathway
    102967427 (PPP3R2)
   04924 Renin secretion
    102967427 (PPP3R2)
  09156 Nervous system
   04724 Glutamatergic synapse
    102967427 (PPP3R2)
   04720 Long-term potentiation
    102967427 (PPP3R2)
  09158 Development and regeneration
   04360 Axon guidance
    102967427 (PPP3R2)
   04380 Osteoclast differentiation
    102967427 (PPP3R2)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102967427 (PPP3R2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102967427 (PPP3R2)
   05014 Amyotrophic lateral sclerosis
    102967427 (PPP3R2)
   05020 Prion disease
    102967427 (PPP3R2)
   05022 Pathways of neurodegeneration - multiple diseases
    102967427 (PPP3R2)
  09165 Substance dependence
   05031 Amphetamine addiction
    102967427 (PPP3R2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102967427 (PPP3R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102967427 (PPP3R2)
   05170 Human immunodeficiency virus 1 infection
    102967427 (PPP3R2)
   05163 Human cytomegalovirus infection
    102967427 (PPP3R2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102967427 (PPP3R2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ptg01009]
    102967427 (PPP3R2)
Protein phosphatases and associated proteins [BR:ptg01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     102967427 (PPP3R2)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Other DBs
NCBI-GeneID: 102967427
NCBI-ProteinID: XP_007089318
LinkDB
Position
Un
AA seq 170 aa
MGNEASYPTEMCSHFNHDEIKRLSKRFKKLDLDCSGSLSVDEFLSLPELRQNPLVQRVID
IFDTNGNGEVDFEEFVVGTSQFSVRGDEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMV
GNNLQDWQLQQIVDKTIIILDRDGDGRISFEEFSAVVGNLEVHKKLVVIV
NT seq 513 nt   +upstreamnt  +downstreamnt
atgggaaatgaagctagttacccgacggagatgtgctcccacttcaaccacgatgaaatt
aaaaggctgagcaagaggtttaagaagctggacttggactgttcaggctctctgagcgtg
gacgagttcttgtccctgcccgagctgcggcagaacccgttggtgcagcgagtgatcgac
atcttcgacaccaacggcaatggagaggtggactttgaggagttcgtcgtggggacctcc
cagttcagcgtcaggggggacgaggagcagaagttgaggtttgccttcagcatctatgac
atggataaagacggctacatttccaacggggagctgttccaggtgctgaagatgatggtg
gggaacaacctgcaagactggcagttacagcagatcgtggacaaaaccatcatcatcctg
gacagggatggcgacgggagaatatccttcgaggaattcagtgcggtggttggaaacctg
gaggtccacaagaagttggtggtaattgtgtga

DBGET integrated database retrieval system