KEGG   Panthera tigris altaica (Amur tiger): 102949568
Entry
102949568         CDS       T02988                                 

Gene name
EPHX1
Definition
(RefSeq) epoxide hydrolase 1
  KO
K01253  microsomal epoxide hydrolase [EC:3.3.2.9]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00980  Metabolism of xenobiotics by cytochrome P450
ptg04976  Bile secretion
ptg05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102949568 (EPHX1)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    102949568 (EPHX1)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    102949568 (EPHX1)
Enzymes [BR:ptg01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.9  microsomal epoxide hydrolase
     102949568 (EPHX1)
Peptidases and inhibitors [BR:ptg01002]
 Serine peptidases
  Family S33
   102949568 (EPHX1)
SSDB
Motif
Pfam: EHN
Other DBs
NCBI-GeneID: 102949568
NCBI-ProteinID: XP_015399936
LinkDB
Position
Un
AA seq 471 aa
MHVAVMHLKTKRRYTGDVEGEGHSFGNSCGHGKRGAFWGKRTTPRAPVADPGHLTLPEGL
GFASPVTVSGRCGSARLLETNLLCSAPPTPLSLGSCISLQDLHRRIDGTRLTPPLEDSRF
HYGFNSNYLKKILSYWRNEFDWGKQVEMLNRYPHFKTRIEGMFPRRQRERGVRLRSGLVA
AGGAPDPEPKRTPRVTSCDSVLLPSQPGLNSVATARVFYKLMLRLGLPEFFISLGEARTF
WKLCISPSPTPPSSCRPPPTLALALALTPASPGPALCPHSHVKGLHLNMAFILNGRILTL
FLVRHCPRLFGFTQRDVELMLPFKIFYRPLRESGYMHIQSTKPDTVVMSEGGKQAGPEAA
LWCTRGSAAILFCFRRKFSLDDLLTNVMLYWTTGAITSSQRFYKENRGQLFKQDRVKVSV
PTGLAAFPCELMHVPERWVKGKYPRLVSYSYMPRGGHFAALEEPELLAQDI
NT seq 1413 nt   +upstreamnt  +downstreamnt
atgcatgtagcagtgatgcacttaaaaacaaagaggagatatacgggtgacgtcgagggt
gaaggacacagcttcgggaacagctgcggtcatgggaaacgaggtgccttctggggaaag
cggacgaccccgagggcacctgtggcggacccggggcacctcaccctccccgagggactt
ggcttcgcctcccctgtcacagtatctggccgctgcgggtctgctcgccttctggaaaca
aaccttctgtgctctgccccacccacccctctctccctggggtcctgcatttcgctccag
gacttacaccgcaggatcgacgggacccgtttaaccccacctttggaggacagccgcttc
cattatggcttcaactccaactacctgaagaagatcctctcctactggcggaatgaattt
gactgggggaagcaggtggagatgctcaacaggtaccctcacttcaagaccaggatcgaa
ggtatgttccccagacgccagcgggagaggggtgtgcgtctcaggagcggccttgtagct
gccggaggggccccggacccagagcccaagaggaccccacgagtgacttcctgtgactct
gttctccttccctcccaaccaggcttgaattcagtggccaccgccagggtcttttacaaa
ctgatgctgcggctgggcctcccggagtttttcatttccctgggagaagccagaactttc
tggaaactctgtatttccccctccccaacgcctccctcctcctgccggcctccccccacc
cttgccctggccctggccctgacgccagcctcaccggggcccgctctctgccctcacagc
catgtgaaaggcctgcacttgaacatggctttcattttaaatggccgcatcctgaccctc
ttcctggttcggcattgcccgaggctcttcggtttcacccagagggatgtggagctgatg
ttgcccttcaagattttctacagacctctgcgggagagcggctacatgcacatccagagc
accaagcccgacaccgtggtgatgtctgaggggggaaagcaggcaggcccggaggctgcc
ctctggtgcacccggggctcagcagccatcttgttctgcttccgcagaaagttctccctg
gacgacctgctgaccaacgtcatgctctactggacaactggcgccatcacctcctcccag
cgcttctacaaggagaacagggggcagctcttcaagcaggatcgggtcaaggtgtcggtg
cccaccggcctggccgccttcccgtgtgagctgatgcacgtaccggagaggtgggtgaag
ggcaagtacccgaggctcgtgtcctactcctacatgccccgcgggggccactttgccgcc
ctcgaggagccggagctgctggcgcaggacatc

DBGET integrated database retrieval system