KEGG   Panthera tigris altaica (Amur tiger): 102949666
Entry
102949666         CDS       T02988                                 

Gene name
GCLC
Definition
(RefSeq) glutamate-cysteine ligase catalytic subunit
  KO
K11204  glutamate--cysteine ligase catalytic subunit [EC:6.3.2.2]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00270  Cysteine and methionine metabolism
ptg00480  Glutathione metabolism
ptg01100  Metabolic pathways
ptg01240  Biosynthesis of cofactors
ptg04216  Ferroptosis
Module
ptg_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    102949666 (GCLC)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102949666 (GCLC)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    102949666 (GCLC)
Enzymes [BR:ptg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.2  glutamate---cysteine ligase
     102949666 (GCLC)
SSDB
Motif
Pfam: GCS GCS2
Other DBs
NCBI-GeneID: 102949666
NCBI-ProteinID: XP_015399022
LinkDB
Position
Un
AA seq 754 aa
MVNACPELVTAAVAGIKAHTELSDHSAIVHGPADCHMEQQPGVGDGRVSGVEGRNFAPSS
IPAVTSSTEQAQSAESRGGGTARLEAGPAQSRGEGCITTTTRRAAPAARAASSRYRAALR
ACSARPRVYKIRSYGSRLGAASEQIGRLGMLGGGAGLGHNVLRWGDEVEYMLVSFDHENK
RVQLVLSGEEVLETLQEKGERTNPNHPTLWRPEYGSYMIEGTPGQPYGGTMSEFNTVEDN
MRKRRKEATSLLGENQALCTITSFPRLGCPGFTLPEFKPNPLEGGASKSLFFPDEAINKH
PRFSTLTRNIRHRRGEKVVINVPIFKDKNTPSPFMETFPEDEEAARASKPDHIYMDAMGF
GMGNCCLQVTFQACSISEARYLYDQLATICPIVMALSAASPFYRGYVSDIDCRWGVISAS
VDDRTREERGLEPLKNNSYRISKSRYDSIDSYLSECGEKYNDIDLTIDKEIYEQLLQEGI
DHLLAQHVAHLFIRDPLTLFEEKIHLDDANESDHFENIQSTNWQTMRFKPPPPNSDIGWR
VEFRPMEVQLTDFENSAYVVFVVLLTRVILSYKLDFLIPLSKVDENMKVAQKRDAVLRGM
FYFRKDICKGGNTVVDGYGKAQNTSELTTEDYTLMSIDTIINGKEGVFPGLIPILNSYLE
NMEVDVDTRCSILNYLKLIKKRASGELMTVARWMREFISNHPDYKRDSVITDEMNYSLIL
KCNQIADELCECPELLGPAFRKVKYSGSKTDPSN
NT seq 2265 nt   +upstreamnt  +downstreamnt
atggttaatgcctgcccagaactggtcactgcagctgtggctggaataaaagcccacaca
gagctctcagatcacagcgccatcgtccatgggcctgccgattgccacatggagcagcag
ccgggtgtgggggatgggagagtgtcaggagtggagggccgaaactttgccccaagcagc
atcccggcagtgacctctagcacagaacaggcacaaagtgctgagtcacggggaggcggc
accgcgcgcctggaggcgggcccggcgcagtcacgtggcgagggctgtatcacaacaacg
acgcggcgtgcagcgccggccgcccgcgccgcttcctcccgctatcgagccgccctccga
gcatgctcagctcggccccgcgtctataaaatccggagctacggatcgcgcctcggagcg
gcgagcgagcagataggaagactgggcatgctcggtggcggcgcaggtcttggtcacaac
gtgctcaggtggggcgacgaggtggaatacatgttggtgtcttttgatcatgaaaataag
agagtccagttggtcctgtctggagaagaagttcttgaaactctacaagaaaagggggaa
aggacaaacccaaaccatcctaccctgtggagaccagagtatggcagttacatgattgaa
ggcacacctggacaaccgtacggaggaacaatgtccgagttcaacacagttgaagacaac
atgagaaaacgccggaaggaggcaacctctttattaggagaaaatcaggctctttgcaca
ataacttcatttcccagattaggctgtcctgggttcacgctgccagagtttaaacccaat
ccgctcgaaggaggagcttccaagtccctcttctttcctgatgaagccataaacaagcat
ccccgcttcagtaccctgacaagaaatatccgacacaggagaggagaaaaggttgtcatc
aatgtaccaatatttaaggacaagaatacaccatctccatttatggaaacatttcctgag
gatgaggaggcagcaagggcttccaagcctgatcatatttacatggatgccatgggattt
gggatgggtaattgctgtcttcaggtaacgttccaagcctgcagcatatctgaggctaga
tacctttatgatcagctggccaccatctgtccaattgtcatggctttgagtgctgcgtct
cctttttaccgaggctatgtgtcagacattgattgtcgctggggagtgatttctgcatct
gtagatgatagaactcgggaggagagaggactggagccactgaagaacaatagctatagg
atcagtaaatcccgatatgattcaatagacagttacttatctgagtgtggggagaaatac
aatgacattgacttgacaattgataaagaaatctacgaacagctgctgcaggaaggcatt
gatcatctcctggcccagcatgtcgctcatctcttcatcagagacccactgactctattc
gaagagaaaatacacttggatgatgccaatgaatcggaccattttgagaacattcagtcc
acaaattggcagacaatgagatttaagccccctcctccaaactctgacattggatggaga
gtagaattccgacccatggaggttcagttaacagactttgagaactctgcatatgtggta
tttgtggtgctgcttacaagagtgatcctttcatacaaactggattttctcattccacta
tcaaaggttgatgaaaacatgaaagttgcacagaaacgagatgctgtcttgcggggaatg
ttttatttcaggaaagatatttgcaaaggtgggaacactgtggtggatggctacgggaag
gcccagaacacctcggaactgaccacggaggactacaccctgatgagcatagacaccatc
atcaacgggaaggagggtgtgtttcctgggctgatcccgattctgaactcttaccttgaa
aacatggaggtggatgtggacactagatgtagtattctgaactacttaaagctaattaag
aagagagcatctggagaactaatgacagttgccagatggatgagagagtttatctccaac
catcctgactataagcgagacagtgtaatcactgatgaaatgaactatagcctcatctta
aagtgtaaccaaattgcagacgaattgtgtgagtgcccggagttacttggaccagcgttt
aggaaagtgaaatacagtggaagtaaaacggacccgtccaactga

KEGG   Panthera tigris altaica (Amur tiger): 102961711
Entry
102961711         CDS       T02988                                 

Gene name
GCLM
Definition
(RefSeq) glutamate-cysteine ligase modifier subunit
  KO
K11205  glutamate--cysteine ligase regulatory subunit
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00270  Cysteine and methionine metabolism
ptg00480  Glutathione metabolism
ptg01100  Metabolic pathways
ptg01240  Biosynthesis of cofactors
ptg04216  Ferroptosis
Module
ptg_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    102961711 (GCLM)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102961711 (GCLM)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    102961711 (GCLM)
SSDB
Motif
Pfam: Aldo_ket_red
Other DBs
NCBI-GeneID: 102961711
NCBI-ProteinID: XP_007073492
LinkDB
Position
Un
AA seq 272 aa
MGAERASTWLPPSPSPAAPSPLPTPRPAEDSVETRFSGIQLRDCIQKTLNEWSSQISPDL
VREFPDVLECTVSHAVEKINPDEREEMKVSAKLFIVGSNSSSSTRNAVDMACSVLGVAQL
DSVIIASPPIEDGVNLSLEHLQPYWEELENLVQSKKIVAIGTSDLDKTQLEQLYQWAQVK
PNSNQVNLASCCVMPPDLTAFAKQFDIQLLTHNDPKELLSEASFQEALQESIPDIQAHEW
VPLWLLRYSVIVKSRGIIKSKGYILQAKRRGS
NT seq 819 nt   +upstreamnt  +downstreamnt
atgggtgcagagagagccagcacctggctcccaccctctcccagccccgcggccccttcc
cccctccccaccccgcggccagctgaagacagtgtagagactcgcttttccgggattcag
cttcgagattgtatccaaaagaccttgaatgagtggagttcccaaatcagccctgatttg
gtcagggagtttccagatgtcttggaatgtactgtatctcatgcagtagaaaagataaat
cctgatgaaagagaagaaatgaaagtttctgcaaaactgttcattgtaggatcaaactct
tcatcatcaactagaaatgcagttgacatggcctgttcagtccttggagttgcacagctg
gattctgtgatcattgcttcacctcctattgaagatggagttaatctttccttggagcat
ttgcagccttactgggaggaattagaaaacttagttcagagcaaaaagattgttgcaata
ggtacctctgatctagacaaaacacagttggaacagctgtatcagtgggcacaggtaaaa
ccaaatagtaaccaagttaatcttgcctcttgctgtgtgatgccacctgatttgactgca
tttgctaaacaatttgacatacagctattgactcataatgatccaaaagaactgctttct
gaagccagtttccaagaagctcttcaggaaagcatccctgacattcaagcacacgagtgg
gtgcccctgtggctactgcggtattcagtcattgttaaaagtagaggaattatcaaatca
aaaggctacatcttacaagctaaaagaaggggttcctaa

DBGET integrated database retrieval system