KEGG   Panthera tigris altaica (Amur tiger): 102949760
Entry
102949760         CDS       T02988                                 

Gene name
TGFB3
Definition
(RefSeq) transforming growth factor beta 3
  KO
K13377  transforming growth factor beta-3
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04010  MAPK signaling pathway
ptg04060  Cytokine-cytokine receptor interaction
ptg04068  FoxO signaling pathway
ptg04110  Cell cycle
ptg04218  Cellular senescence
ptg04350  TGF-beta signaling pathway
ptg04390  Hippo signaling pathway
ptg04933  AGE-RAGE signaling pathway in diabetic complications
ptg05140  Leishmaniasis
ptg05142  Chagas disease
ptg05144  Malaria
ptg05145  Toxoplasmosis
ptg05146  Amoebiasis
ptg05152  Tuberculosis
ptg05161  Hepatitis B
ptg05166  Human T-cell leukemia virus 1 infection
ptg05200  Pathways in cancer
ptg05210  Colorectal cancer
ptg05211  Renal cell carcinoma
ptg05212  Pancreatic cancer
ptg05220  Chronic myeloid leukemia
ptg05225  Hepatocellular carcinoma
ptg05226  Gastric cancer
ptg05321  Inflammatory bowel disease
ptg05323  Rheumatoid arthritis
ptg05410  Hypertrophic cardiomyopathy
ptg05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102949760 (TGFB3)
   04350 TGF-beta signaling pathway
    102949760 (TGFB3)
   04390 Hippo signaling pathway
    102949760 (TGFB3)
   04068 FoxO signaling pathway
    102949760 (TGFB3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102949760 (TGFB3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102949760 (TGFB3)
   04218 Cellular senescence
    102949760 (TGFB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102949760 (TGFB3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102949760 (TGFB3)
   05212 Pancreatic cancer
    102949760 (TGFB3)
   05225 Hepatocellular carcinoma
    102949760 (TGFB3)
   05226 Gastric cancer
    102949760 (TGFB3)
   05220 Chronic myeloid leukemia
    102949760 (TGFB3)
   05211 Renal cell carcinoma
    102949760 (TGFB3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    102949760 (TGFB3)
   05321 Inflammatory bowel disease
    102949760 (TGFB3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102949760 (TGFB3)
   05414 Dilated cardiomyopathy
    102949760 (TGFB3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102949760 (TGFB3)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102949760 (TGFB3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102949760 (TGFB3)
   05161 Hepatitis B
    102949760 (TGFB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102949760 (TGFB3)
   05144 Malaria
    102949760 (TGFB3)
   05145 Toxoplasmosis
    102949760 (TGFB3)
   05140 Leishmaniasis
    102949760 (TGFB3)
   05142 Chagas disease
    102949760 (TGFB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ptg04052]
    102949760 (TGFB3)
Cytokines and growth factors [BR:ptg04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   102949760 (TGFB3)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 102949760
NCBI-ProteinID: XP_007095094
LinkDB
Position
Un
AA seq 418 aa
MKMHLHRALVVLALLHLPRVLTFATVSLSLSTCTTLDFGHIKKKRVEAIRGQILSKLRLT
SPPEPSVMTHVPYQVLALYNSTRELLEEMQGEREDSCTQENTESEYYAKEIHKFDMIQGL
AEHNELAVCPKGITSKVFRFNVSSVEKNGTNLFRAEFRVLRVPNPSSKRSEQRIELFQIL
RPDEHIAKQRYIGGKNLPTRGTAEWLSFDVTDTVREWLLRRESNLGLEISIHCPCHTFQP
NGDILENIHEVMEIKFKGVDSEDDHGRGDLGRLKKQKDHHNPHLILMMIPPHRLDNPGQG
GQRKKRALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPYLRSA
DTTHSTVLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgaagatgcacttgcacagggctctggtggtcctggccctgctgcacttgccacgggtg
ctgacctttgccacggtcagcctctctctgtccacttgcaccaccttggactttggccac
atcaagaagaagagggtggaagccattaggggacagatcttgagcaagctcaggctcacc
agtccccccgagccatcggtgatgacccacgtcccctaccaggtcctggccctttacaac
agcacccgggagctgctggaggagatgcagggggagagggaggacagctgcactcaggaa
aacaccgagtcggagtactatgccaaagaaatccataaattcgacatgatccaggggctg
gcggagcacaatgagctggccgtctgccccaaagggatcacctccaaggtcttccgcttc
aacgtgtcctcagtggagaaaaatggaaccaacctgttccgagcggaattccgggtcttg
cgggtgcccaaccccagctctaagcgcagtgagcagaggatcgagctcttccagatactc
cggcccgatgagcacatcgccaaacagcgctatatcggtggcaaaaatctgcccacacgg
ggcactgccgaatggctgtctttcgacgtcactgacaccgtgcgggaatggctcttgcga
agagagtccaacttaggtctggaaatcagcattcactgtccgtgtcacacatttcagccc
aatggagacatcttggaaaacattcatgaggtgatggaaatcaaattcaaaggtgtggac
agcgaggatgatcatggccgtggggatctcgggcgcctcaagaagcagaaggaccaccac
aaccctcacctcatcctcatgatgattcccccgcaccggctggacaacccgggccagggc
gggcagaggaagaagcgggccctggacaccaactactgcttccgcaatttggaggagaac
tgctgtgtgcgccctctctacattgacttccgacaagatctgggctggaaatgggtccac
gaacctaagggctactatgccaacttctgctcaggcccctgcccctacctccgcagtgcg
gacacaacccacagcacggtgctgggactgtacaacaccctgaatcccgaagcctctgcc
tcaccttgctgtgtgccccaggacttggagcccctgaccatcctgtactatgtcgggagg
acccccaaggtggaacagctctctaacatggtggtcaagtcctgtaagtgtagctga

KEGG   Panthera tigris altaica (Amur tiger): 102951285
Entry
102951285         CDS       T02988                                 

Gene name
TGFB1
Definition
(RefSeq) transforming growth factor beta 1
  KO
K13375  transforming growth factor beta-1
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04010  MAPK signaling pathway
ptg04060  Cytokine-cytokine receptor interaction
ptg04068  FoxO signaling pathway
ptg04110  Cell cycle
ptg04218  Cellular senescence
ptg04350  TGF-beta signaling pathway
ptg04380  Osteoclast differentiation
ptg04390  Hippo signaling pathway
ptg04659  Th17 cell differentiation
ptg04672  Intestinal immune network for IgA production
ptg04926  Relaxin signaling pathway
ptg04932  Non-alcoholic fatty liver disease
ptg04933  AGE-RAGE signaling pathway in diabetic complications
ptg05140  Leishmaniasis
ptg05142  Chagas disease
ptg05144  Malaria
ptg05145  Toxoplasmosis
ptg05146  Amoebiasis
ptg05152  Tuberculosis
ptg05161  Hepatitis B
ptg05166  Human T-cell leukemia virus 1 infection
ptg05200  Pathways in cancer
ptg05205  Proteoglycans in cancer
ptg05210  Colorectal cancer
ptg05211  Renal cell carcinoma
ptg05212  Pancreatic cancer
ptg05220  Chronic myeloid leukemia
ptg05225  Hepatocellular carcinoma
ptg05226  Gastric cancer
ptg05321  Inflammatory bowel disease
ptg05323  Rheumatoid arthritis
ptg05410  Hypertrophic cardiomyopathy
ptg05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102951285 (TGFB1)
   04350 TGF-beta signaling pathway
    102951285 (TGFB1)
   04390 Hippo signaling pathway
    102951285 (TGFB1)
   04068 FoxO signaling pathway
    102951285 (TGFB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102951285 (TGFB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102951285 (TGFB1)
   04218 Cellular senescence
    102951285 (TGFB1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102951285 (TGFB1)
   04672 Intestinal immune network for IgA production
    102951285 (TGFB1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    102951285 (TGFB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102951285 (TGFB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102951285 (TGFB1)
   05205 Proteoglycans in cancer
    102951285 (TGFB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102951285 (TGFB1)
   05212 Pancreatic cancer
    102951285 (TGFB1)
   05225 Hepatocellular carcinoma
    102951285 (TGFB1)
   05226 Gastric cancer
    102951285 (TGFB1)
   05220 Chronic myeloid leukemia
    102951285 (TGFB1)
   05211 Renal cell carcinoma
    102951285 (TGFB1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    102951285 (TGFB1)
   05321 Inflammatory bowel disease
    102951285 (TGFB1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102951285 (TGFB1)
   05414 Dilated cardiomyopathy
    102951285 (TGFB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102951285 (TGFB1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102951285 (TGFB1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102951285 (TGFB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102951285 (TGFB1)
   05161 Hepatitis B
    102951285 (TGFB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102951285 (TGFB1)
   05144 Malaria
    102951285 (TGFB1)
   05145 Toxoplasmosis
    102951285 (TGFB1)
   05140 Leishmaniasis
    102951285 (TGFB1)
   05142 Chagas disease
    102951285 (TGFB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ptg03110]
    102951285 (TGFB1)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ptg04052]
    102951285 (TGFB1)
   00536 Glycosaminoglycan binding proteins [BR:ptg00536]
    102951285 (TGFB1)
Chaperones and folding catalysts [BR:ptg03110]
 Intramolecular chaperones
  Others
   102951285 (TGFB1)
Cytokines and growth factors [BR:ptg04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   102951285 (TGFB1)
Glycosaminoglycan binding proteins [BR:ptg00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   102951285 (TGFB1)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 102951285
NCBI-ProteinID: XP_015394996
LinkDB
Position
Un
AA seq 278 aa
MVENKNKIYEKVQRTPHSIYMLFNTSELREAVPEPVLLSRAELRLLRLKLKAEQHVELYQ
KYSNNSWRYLSNRLLAPSDTPEWLSFDVTGVVRQWLSHGGEVEGFRLSAHCSCDSKDNTL
QVDINGFSSGRRGDLATIHGMNRPFLLLMATPLERAQHLHSSRHRRALDTNYCFSSTEKN
CCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASA
APCRVPAAAGAPRFSSLPPPPTHSALTFPGPPDLLLAQ
NT seq 837 nt   +upstreamnt  +downstreamnt
atggtggaaaacaaaaacaaaatctatgagaaagtccagcgtaccccgcacagcatatat
atgctctttaacacgtcggagctccgagaagcagtgcccgagcccgtcttgctctcccgg
gcagagttgcgcctgctgaggctcaagttaaaggcggagcagcacgtggagctgtaccag
aaatacagcaataattcctggcgctacctcagcaaccggctgctggcgcccagtgacacg
ccggaatggctgtcctttgatgtcactggagtggtgcggcagtggctgagccatggaggg
gaagtagagggctttcgcctcagtgcccactgttcctgtgacagcaaagataacacgctg
caagtggacatcaacgggttcagttccggccgccgaggtgacctggccaccattcatggc
atgaaccggccttttctgctcctcatggccaccccgctggagagggcccagcacctgcac
agctcacggcaccgccgagccctggacaccaactactgcttcagctccacggagaagaac
tgctgcgtgcggcagctctatattgacttccgcaaggatctgggctggaagtggatccac
gagcccaagggctaccacgccaacttctgcctagggccctgtccctacatctggagcctg
gacacgcagtacagcaaggtcctggccctgtacaaccagcacaacccgggcgcgtcggcg
gctccctgccgcgtgcccgcggcggcgggggccccgcgtttcagttccctccccccaccc
cccacccactctgccctgaccttcccagggccaccggacctgctcctggcccagtga

KEGG   Panthera tigris altaica (Amur tiger): 102951894
Entry
102951894         CDS       T02988                                 

Gene name
TGFB2
Definition
(RefSeq) transforming growth factor beta 2
  KO
K13376  transforming growth factor beta-2
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04010  MAPK signaling pathway
ptg04060  Cytokine-cytokine receptor interaction
ptg04068  FoxO signaling pathway
ptg04110  Cell cycle
ptg04218  Cellular senescence
ptg04350  TGF-beta signaling pathway
ptg04380  Osteoclast differentiation
ptg04390  Hippo signaling pathway
ptg04933  AGE-RAGE signaling pathway in diabetic complications
ptg05140  Leishmaniasis
ptg05142  Chagas disease
ptg05144  Malaria
ptg05145  Toxoplasmosis
ptg05146  Amoebiasis
ptg05152  Tuberculosis
ptg05161  Hepatitis B
ptg05166  Human T-cell leukemia virus 1 infection
ptg05200  Pathways in cancer
ptg05205  Proteoglycans in cancer
ptg05206  MicroRNAs in cancer
ptg05210  Colorectal cancer
ptg05211  Renal cell carcinoma
ptg05212  Pancreatic cancer
ptg05220  Chronic myeloid leukemia
ptg05225  Hepatocellular carcinoma
ptg05226  Gastric cancer
ptg05321  Inflammatory bowel disease
ptg05323  Rheumatoid arthritis
ptg05410  Hypertrophic cardiomyopathy
ptg05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102951894 (TGFB2)
   04350 TGF-beta signaling pathway
    102951894 (TGFB2)
   04390 Hippo signaling pathway
    102951894 (TGFB2)
   04068 FoxO signaling pathway
    102951894 (TGFB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102951894 (TGFB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102951894 (TGFB2)
   04218 Cellular senescence
    102951894 (TGFB2)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102951894 (TGFB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102951894 (TGFB2)
   05206 MicroRNAs in cancer
    102951894 (TGFB2)
   05205 Proteoglycans in cancer
    102951894 (TGFB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102951894 (TGFB2)
   05212 Pancreatic cancer
    102951894 (TGFB2)
   05225 Hepatocellular carcinoma
    102951894 (TGFB2)
   05226 Gastric cancer
    102951894 (TGFB2)
   05220 Chronic myeloid leukemia
    102951894 (TGFB2)
   05211 Renal cell carcinoma
    102951894 (TGFB2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    102951894 (TGFB2)
   05321 Inflammatory bowel disease
    102951894 (TGFB2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102951894 (TGFB2)
   05414 Dilated cardiomyopathy
    102951894 (TGFB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102951894 (TGFB2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102951894 (TGFB2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102951894 (TGFB2)
   05161 Hepatitis B
    102951894 (TGFB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102951894 (TGFB2)
   05144 Malaria
    102951894 (TGFB2)
   05145 Toxoplasmosis
    102951894 (TGFB2)
   05140 Leishmaniasis
    102951894 (TGFB2)
   05142 Chagas disease
    102951894 (TGFB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ptg04052]
    102951894 (TGFB2)
   00536 Glycosaminoglycan binding proteins [BR:ptg00536]
    102951894 (TGFB2)
Cytokines and growth factors [BR:ptg04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   102951894 (TGFB2)
Glycosaminoglycan binding proteins [BR:ptg00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   102951894 (TGFB2)
SSDB
Motif
Pfam: TGF_beta TGFb_propeptide Cytomega_UL84
Other DBs
NCBI-GeneID: 102951894
NCBI-ProteinID: XP_015390262
LinkDB
Position
Un
AA seq 398 aa
MEASLLGPVVPDLLEKACQAVAESVLSKAQQPQRKAGTLPALDGSVEPKPSILLGVEELR
PEGFADAPHYRFCPVREGARTLGLTVRTVSNSSEAEAKSHAIPPTFYRPYFRIVRFDVSA
MEKNASNLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKTRAEG
EWLSFDVTDAVHEWLHHKDRNLGFKISLHCPCCTFVPSNNYIIPNKSEELEARFAGIDGT
STYTSGDQKTIKSTRKKNSGKTPHLLLMLLPSYRLESQQSNRRKKRALDAAYCFRNVQDN
CCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASA
SPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
NT seq 1197 nt   +upstreamnt  +downstreamnt
atggaggcgagcttgcttggccccgtggtgcccgaccttctagaaaaggcatgccaagct
gtagccgagtccgtgctttctaaagcccagcaacctcagcggaaggcagggactctccca
gccttagacggaagcgtggagcccaagcccagcatcctcttaggtgtggaggaactgaga
ccggaagggtttgctgatgcgccacattaccgcttttgccctgtgcgggaaggggcccga
acactcgggctgacggtgcgcacggtctcaaatagcagtgaggcggaggccaagtcacat
gccatcccgcccactttctacagaccttacttcagaattgtccgatttgacgtctcagcg
atggagaagaatgcatccaatttggtgaaagcggagttcagagtctttcgtttacagaac
ccgaaggccagagtgcccgaacaaaggatcgaactgtatcagattctcaaatccaaagac
ttaacgtctccaacccagcgctacattgacagcaaagtcgtgaagacaagggcagaaggc
gaatggctttccttcgatgtaactgacgccgttcatgaatggctccaccataaagacaga
aacctgggatttaaaataagcttacactgtccctgctgcacctttgtaccatctaataat
tacatcattcccaataaaagtgaagagctagaagcaagatttgcaggtattgatggcacc
tccacatataccagtggtgatcagaaaactataaagtccactaggaaaaaaaacagtgga
aagaccccacacctcctgctaatgttgttgccctcctacagacttgagtcacaacagtcc
aaccggcggaagaagcgtgctttggatgcagcctattgttttagaaatgtgcaggataat
tgctgcctacgtccactttatattgatttcaagagggatcttgggtggaaatggattcat
gaacctaaagggtacaatgccaacttctgtgctggagcttgcccgtatttatggagttca
gacactcagcacagtagggttctcagcttatataacaccataaacccagaagcatctgct
tctccttgctgtgtgtcccaggatttagaaccgctaaccattctctactatatcggcaaa
acacccaagattgaacagctttcaaatatgattgtaaagtcttgcaaatgcagctaa

DBGET integrated database retrieval system