KEGG   Panthera tigris altaica (Amur tiger): 102949810Help
Entry
102949810         CDS       T02988                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase complex flavoprotein subunit A
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00020  Citrate cycle (TCA cycle)
ptg00190  Oxidative phosphorylation
ptg01100  Metabolic pathways
ptg01200  Carbon metabolism
ptg04714  Thermogenesis
ptg04932  Non-alcoholic fatty liver disease (NAFLD)
ptg05010  Alzheimer disease
ptg05012  Parkinson disease
ptg05016  Huntington disease
Module
ptg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ptg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ptg_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    102949810 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    102949810 (SDHA)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    102949810 (SDHA)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    102949810 (SDHA)
   05012 Parkinson disease
    102949810 (SDHA)
   05016 Huntington disease
    102949810 (SDHA)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    102949810 (SDHA)
Enzymes [BR:ptg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     102949810 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 102949810
NCBI-ProteinID: XP_007087339
LinkDB All DBs
Position
Un
AA seq 665 aa AA seqDB search
MSGVRAVPRLLGARRLALTRAQWPATWQAGTCGFHFTIDGNKRSSAKVSDSISAQYPVVD
HEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNW
RWHFYDTVKGSDWLGDQDAIHYMTEQAPASVVELENYGMPFSRTEDGRIYQRAFGGQSLK
FGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCI
EDGSIHRIRAKNTVVATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHPTG
IYGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGP
EKDHVYLQLHHLPPEQLAIRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKG
QVLRHVNGQDQIVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIAESCRPGD
KVPPIKPNAGEESVMNLDKLRFADGTLRTSELRLNMQKSMQNHAAVFRVGSVLQEGCEKI
SQLYGDLKHLKTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKE
RIDEYDYSKPIQGQQKKPFEEHWRKHTLSYVDIKTGKVSLEYRPVIDRTLNEADCATVPP
AIRSY
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggggtccgggcggtgccgcggctgctgggcgcccggcgcctggcactgactagg
gcgcagtggcccgcgacatggcaggcaggcacctgcggttttcacttcactattgatggg
aataagaggtcttcagctaaagtttcagattcaatttctgcgcaatacccggtagtggac
cacgaatttgatgcggtggtggtaggcgctggaggggcaggcctgcgagctgcgtttggc
ctttccgaggcagggtttaacacggcctgcgtcacaaagctctttcctacgagatcacac
accgtcgcagcccagggagggatcaatgctgctctggggaacatggaggaggacaactgg
aggtggcacttctacgacactgtgaaaggctccgactggctgggggaccaggatgccatc
cactacatgacagagcaggcccctgcttccgtggtagagctggagaattatggcatgcca
ttcagcagaactgaagatgggaggatctaccagcgtgcttttggtggacagagcctcaag
tttgggaaaggcgggcaggcccatcggtgctgctgtgtggctgaccgcactggccactcg
ctgctgcacacgttgtatggaaggtctctgcgatatgataccagctattttgtagagtat
tttgccttggatctcctgatggaaaatggagaatgtcgtggtgttattgcgctgtgcata
gaagacgggtccatccatcgcataagagcaaagaacactgttgtagctactggaggctac
gggcgcacctacttcagctgcacatctgcccacaccagcaccggtgacggcaccgccatg
gtcaccagggcaggccttccctgccaggacttggagttcgttcagtttcaccccacaggt
atatatggtgccggttgtctcattacagaagggtgccgtggagagggaggcattctcatt
aacagtcaaggcgaaagattcatggagcgatatgccccggttgcaaaggacctggcatcc
agagacgtcgtgtctcggtccatgactctggaaatacgtgaaggaagaggctgtggccct
gaaaaagatcacgtctacctgcagttgcaccacctacccccagagcagctggccatacgg
ctgcctggcatttcagagacggccatgatcttcgcaggtgtagatgtcaccaaggagccc
atccccgtccttcccaccgtgcattataacatgggcggcattcccaccaactacaagggg
caggttctgaggcatgtgaatggccaggatcagatcgtgcccggcctgtatgcctgtggg
gaggctgcctgcgcctccgtgcatggtgccaaccgtcttggggcaaactcactcttggat
ctggttgtctttggtcgggcgtgtgccctgagtatcgcggagtcctgcagacccggagat
aaagttcctccaattaaaccaaatgctggagaagagtctgtcatgaatcttgataagttg
aggtttgctgatggaaccctaagaacatcagaactacgactcaacatgcagaagtcgatg
caaaatcatgccgcagtgttccgtgtgggaagtgtgttgcaggaaggttgtgagaaaatc
agccagctctatggagacctaaaacatctgaagacatttgaccgaggaatggtctggaac
accgacctggtggagaccctagagctgcagaacctgatgctttgtgcacttcagaccatt
tatggagcggaggctcggaaggagtcacgtggtgctcatgccagggaagattataaggag
cggattgacgagtatgattactccaagcccatccaggggcagcagaagaagccatttgag
gaacactggaggaagcacaccctttcctatgtcgacatcaagactgggaaggtctccttg
gagtacagacccgtcattgacagaactttgaatgaggcagactgtgccacagtccctcca
gccattcgctcctactga

DBGET integrated database retrieval system