KEGG   Panthera tigris altaica (Amur tiger): 102950049
Entry
102950049         CDS       T02988                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase 2
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00220  Arginine biosynthesis
ptg00330  Arginine and proline metabolism
ptg01100  Metabolic pathways
ptg04020  Calcium signaling pathway
ptg04066  HIF-1 signaling pathway
ptg04146  Peroxisome
ptg04371  Apelin signaling pathway
ptg04926  Relaxin signaling pathway
ptg05010  Alzheimer disease
ptg05014  Amyotrophic lateral sclerosis
ptg05022  Pathways of neurodegeneration - multiple diseases
ptg05133  Pertussis
ptg05140  Leishmaniasis
ptg05142  Chagas disease
ptg05145  Toxoplasmosis
ptg05146  Amoebiasis
ptg05152  Tuberculosis
ptg05200  Pathways in cancer
ptg05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    102950049 (NOS2)
   00330 Arginine and proline metabolism
    102950049 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102950049 (NOS2)
   04066 HIF-1 signaling pathway
    102950049 (NOS2)
   04020 Calcium signaling pathway
    102950049 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102950049 (NOS2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    102950049 (NOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102950049 (NOS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    102950049 (NOS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102950049 (NOS2)
   05014 Amyotrophic lateral sclerosis
    102950049 (NOS2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    102950049 (NOS2)
   05152 Tuberculosis
    102950049 (NOS2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102950049 (NOS2)
   05145 Toxoplasmosis
    102950049 (NOS2)
   05140 Leishmaniasis
    102950049 (NOS2)
   05142 Chagas disease
    102950049 (NOS2)
Enzymes [BR:ptg01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     102950049 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 NAD_binding_6
Other DBs
NCBI-GeneID: 102950049
NCBI-ProteinID: XP_007076102
LinkDB
Position
Un
AA seq 1157 aa
MACPWQFLFKAKSHQYNLTEETDINNNVGKAVWASSGLVTQDDPKCHSLSKHRNEPPQSL
TGTVKTVPESLGKLDMPPSACPRHVRIKNWGSGMTFQDTLHHKAKGDLACRSKSCLGAIM
NPKSLTRGPRDKPTPPDELLPQAIEFVNQYYSSFKEAKIEEHLARVEAVTKEIETTGTYQ
LTGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARSCSTAQEMFEHICRHVRYATNNGNI
RSAITVFPQRSDGKHDFRIWNAQLIRYAGYQMPDGTILGDPASVEFTQLCIDLGWKPKYG
RFDVVPLVLQADGGDPELFEIPPDLVLEVPMEHPKYEWFRELELKWYALPAVANMLLEVG
GLEFPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHKLASLWKDRAVIEINV
AVLHSFQKQNVTIMDHHSAAESFMKYMQNEYRSRGGCPADWIWLVPPISGSITPVFHQEM
LNYVLSPFFYYQVEAWKTHIWQDEKRRPRRRKIPFKVLVQAVLFASMLMRKTMASRVRAT
ILFATETGKSETLARDLGDLFSCAFNPKILCMDQYGLSNLEEEQLLLVVTSTFGNGDSPG
NGEKLKKSLFMLKELTNKFRYAVFGLGSSMYPQFCAFAHDIDQKLSHLGASQLAPTGEGD
ELSGQEEAFRSWAVQTFKAACETFDVRGKHRIQIPKLYTSNVTWDPHHYRLVRDSQPLDL
NKALGSMHAKNVFTMRLKSQRNLQSAKSSRTTLLVELSCEDSHRLSYLPGEHLGVFPGNQ
LALVKGILERVVDGPAPHQPVHLETLSESGSYWVRDKRLPPCSLSQALTYFLDITTPPTQ
LLLRKLAQLATEEAERQRLEILCQPSEYNKWKFTNSPTFLEVLEEFPSLRVSAGFLLSQL
PILKPRYYSISSSRACAPTEVHLTVAVLTYRTRDGQGPLHHGVCSTWLSSLKPQDPVPCF
VRSAGGFQLPEDPSQPCILIGPGTGIAPFRSFWQQRLHDAEHKGLRGSRMTLVFGCRRPD
EDHLYREEMLEMAQKGVLHEVHTAYSRLPGQPKVYVQDILRQQLASEVLRVLHEEQGHLY
VCGDVRMARDVAQTLKHLLAAKLSLSEEQVEDYFFQLKSQKRYHEDIFGAVFPYEVKKDG
AARQPSDPRVPAALGTS
NT seq 3474 nt   +upstreamnt  +downstreamnt
atggcctgtccctggcagtttctgttcaaggccaaatcccaccagtacaacttgactgag
gaaacagacatcaacaacaatgtggggaaggccgtctgggcctcctctggtctagtgaca
caggatgaccccaagtgtcacagcctcagcaaacaccggaatgagcccccccagtccctc
acggggacagtaaagacagttccagaatccctggggaagctggatatgcccccgtcggcc
tgcccacggcacgtgaggatcaaaaactggggcagtgggatgactttccaagacacactt
caccacaaggccaaaggggatcttgcttgcaggtctaagtcttgtctgggagccatcatg
aaccccaaaagtttgaccagaggacccagggacaagcctacccccccagacgagcttcta
cctcaagctatcgaatttgtcaaccagtattacagctccttcaaagaagcaaaaatagag
gaacatctggccagggtggaagcagtaacaaaggagatagaaacaacaggaacctatcag
ctgacgggagatgagctcatcttcgccaccaagcaggcttggcgcaatgccccccgctgc
atcgggaggatccagtggtccaacctacaggtctttgatgcccggagctgttccactgcc
caggaaatgttcgagcacatctgcagacacgtgcgttatgctaccaacaatggcaacatc
aggtcggccatcaccgtgttcccccagcggagtgatgggaagcatgacttccggatctgg
aacgctcagctcatccggtatgctggctaccagatgcctgatggcaccatcctgggggac
cctgccagcgtggagttcacccagctgtgcatcgacctgggctggaagcccaagtacggc
cgctttgatgtggtgcctctggtcctgcaggctgatggcggagaccctgagctctttgaa
atcccacctgacctcgtgctcgaggtgcccatggaacatcccaagtatgagtggttccgt
gaactggagctaaagtggtatgccctgcctgccgtggccaacatgctgctcgaggtgggt
ggcctggagttcccagggtgccccttcaatggctggtacatgggcacggagatcggggtc
cgggacttctgtgacgttcagcgctacaacatcctggaggaagtgggcagaaggatgggc
ctggaaacgcacaagctggcctcactctggaaggaccgggctgtcattgagatcaacgtc
gccgtgctgcacagtttccagaagcaaaacgtgaccatcatggaccaccactcggctgcg
gagtccttcatgaagtacatgcagaacgagtaccggtcccgagggggctgtcctgccgac
tggatttggctggtgcccccgatttctggcagcatcactcccgtgttccaccaggagatg
ttaaactatgtcctgtcccctttcttctactaccaggtggaggcctggaaaacccacatc
tggcaggatgagaagcggagaccccggagaagaaagattccgttcaaagtcttggttcaa
gctgtgctcttcgcctccatgctgatgcgcaagaccatggcgtcccgagtgagagccaca
atcctctttgcgacggagacaggaaagtcagaaacactggcccgggacctaggggacttg
ttcagctgtgccttcaaccccaagattctctgcatggaccagtacgggctgagcaacctg
gaggaagagcagctactactggtggtgaccagcacgtttgggaacggagactcccccggc
aacggagagaaactgaaaaaatccctcttcatgctgaaagagcttaccaacaagttcagg
tatgccgtgttcggcctcggctccagtatgtaccctcagttctgtgcctttgctcatgac
atcgaccagaagctgtcccatctgggggcctctcagcttgccccaacaggggaaggggac
gagctcagtggacaggaggaagccttccgcagctgggccgtgcaaaccttcaaggcagcc
tgtgagacgttcgatgtgcgaggcaagcaccgcattcagatccccaagctctacacctcc
aatgtgacctgggacccgcaccactacaggctcgtgcgggactcacagcctctggacctc
aacaaagctctcggcagtatgcacgccaagaacgtgttcaccatgaggctcaaatcacag
cggaatctccagagtgcgaaatccagccgcaccaccctcctggtggagctctcctgtgag
gacagccaccggctgagctacctgcctggagagcacctcggggttttcccaggcaaccag
ctggctctggtaaaaggcatcttggagcgagtggtggacggccctgcaccccaccaaccg
gtgcacctggagaccctcagcgagagcggaagctactgggtcagagacaagcggctgccc
ccgtgctcgctcagccaggccctcacctactttctggatatcaccacccccccaacccag
ctgctgctccgcaaattggcacagctggccacagaagaggcagagaggcagaggctggag
atcctgtgccagccctcagagtacaacaaatggaagttcaccaatagccccacattcctg
gaggtactggaggagttcccatccctgcgggtgtctgctggcttcctgctctcccagctg
cctattctgaaaccccggtactactccatcagctcctccagggcctgtgcacccacggag
gtccacctcactgtggctgtgctcacctaccgcacccgagatggccaaggtcccttgcac
cacggcgtctgcagcacatggctcagcagcctgaagccccaagacccagtaccctgcttt
gtgagaagtgccggcggcttccagctccctgaggacccttcccaaccttgcatcctcatt
gggcctggcacaggcatcgcccccttccgcagcttctggcagcagcggctccatgatgcc
gagcacaaagggctccggggcagccgcatgaccctggtctttgggtgccgccgcccggat
gaggaccacctctatcgggaggagatgttggagatggcccagaagggggtgctgcatgag
gttcacacagcctactctcgcctgcctggccagcccaaggtctatgttcaagacatcctg
aggcagcagctggccagcgaggtgctccgtgtgctccatgaggagcaaggccacctttat
gtctgtggggatgtgcgtatggcccgggatgtggcccaaaccctgaagcacctcctggcc
gccaagctgagcctgagcgaggagcaggtggaggactatttcttccaacttaagagccag
aagcgctatcatgaagacatctttggtgctgtatttccctacgaggtgaaaaaggatggg
gcagcaaggcagcccagcgatcccagagttccagcggccctcgggacaagttaa

DBGET integrated database retrieval system