KEGG   Panthera tigris altaica (Amur tiger): 102950123Help
Entry
102950123         CDS       T02988                                 

Gene name
GYS1
Definition
(RefSeq) glycogen synthase 1
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00500  Starch and sucrose metabolism
ptg01100  Metabolic pathways
ptg04151  PI3K-Akt signaling pathway
ptg04152  AMPK signaling pathway
ptg04910  Insulin signaling pathway
ptg04922  Glucagon signaling pathway
ptg04931  Insulin resistance
Module
ptg_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102950123 (GYS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102950123 (GYS1)
   04152 AMPK signaling pathway
    102950123 (GYS1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102950123 (GYS1)
   04922 Glucagon signaling pathway
    102950123 (GYS1)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04931 Insulin resistance
    102950123 (GYS1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ptg01003]
    102950123 (GYS1)
Enzymes [BR:ptg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     102950123 (GYS1)
Glycosyltransferases [BR:ptg01003]
 Polysaccharide
  Storage polysaccharide
   102950123 (GYS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_4 Glyco_transf_5 Glycos_transf_1 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 102950123
NCBI-ProteinID: XP_015394640
LinkDB All DBs
Position
Un
AA seq 745 aa AA seqDB search
MPLSRTLSMSSLPGLEDWEDEFDLENTVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGD
NYYLVGPYTEQGVRTQVELLEPPTPALKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVG
ASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQNEEKPHVVAHFH
EWLAGIGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYH
RYCMERAAAHCAHIFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQ
TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKML
DKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPE
FLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEE
HIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY
LGRYYMSARHMALAKAFPEHFTYEPHEADATQGYRYRRPPRPGATSAPPSGRAAPPAPLP
PAGASAAPWTQRPPAQSALPASPSAPPAPWARSATKSRRPTLPAHPASLVQRADAEWHCS
ETPLHIPNPPWGPQPRPLRRTLQPF
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgcctctaagccgcactttgtccatgtcctcactgccaggactggaggattgggaggat
gaattcgacctggagaatacagtgctcttcgaggtggcctgggaggtggccaacaaggtg
ggcggcatctacacggtgctacagacgaaggcgaaagtgacaggggatgaatggggtgac
aactactacctggtgggaccgtacacggagcagggcgtgaggacccaggtggaactgctc
gagcccccaaccccagccctgaagaggacgttggactccatgaacagcaagggctgcaag
gtgtatttcggacgctggctgatcgaggggggccccctggtggtgctcctggacgtgggg
gcctcagcctgggccctggagcgctggaagggggagctctgggacacctgcaacatcggg
gtgccttggtacgaccgtgaggccaacgacgccgtcctttttggcttcctcaccacctgg
ttcctgggtgagttcctggcccagaacgaggagaagccacacgtggttgcacacttccac
gagtggttggcgggcattggcctctgcctgtgccgggcccggcggctgcccgtggccaca
atcttcaccacccacgccacactgctgggacgctacctgtgtgccggtgccgtggacttc
tataacaacctggagaatttcaatgtggacaaggaagcaggggagaggcaaatctatcac
cgctactgcatggagcgggcagcggcccactgcgctcacatctttactactgtgtcccag
attactgccatcgaggctcagcacctgctcaagaggaaaccagatatcgtgacccccaat
ggactgaatgtgaagaagttctctgccatgcatgagttccagaacctccatgctcagagc
aaggctcgaatccaggagtttgtgcggggccatttttatgggcacctggacttcaacttg
gacaagaccttgtatttctttatcgccggccgctacgagttctctaacaagggggccgat
gtcttcctagaggccttggcccggctcaactatctactcagagtgaacggcagtgagcag
acagtggtcgccttcttcatcatgccggctcggaccaacaatttcaacgtggaaaccctc
aaaggccaagctgtgcgcaagcagctttgggatacggccaacaccgtgaaagagaagttc
ggaaggaagctttacgagtccttgctggtggggagcctcccggacatgaacaagatgctg
gacaaggaggacttcactatgatgaagagagctatctttgccacgcagcgacagtctttc
ccccctgtgtgcacccacaatatgctggacgactcctcggatcctatcctgaccaccatc
cgtcgaatcggactcttcaatagtagtgctgacagggtcaaggtgattttccacccagag
ttcctctcctccacgagccccctgctccccgtggattatgaggaatttgtccgtggctgc
caccttggggtcttcccctcctactatgagccttggggctacacgccggctgagtgcacg
gttatgggcatccccagtatctccaccaacctctccggcttcggctgcttcatggaggaa
cacattgcagacccctcagcctacggcatctacattctggaccggcggttccgcagcctg
gatgattcctgctcgcagctcacctccttcctctacagcttctgccagcagagccggcgg
cagcgcatcatccagagaaaccgcacggagcgcctctcagaccttctagactggaaatac
ctgggccggtactatatgtccgcgcgccacatggcgctggccaaggcctttccagaacac
ttcacctatgagccccacgaggctgacgcgacccagggctaccgctacaggaggccgcca
aggcccggcgcaacatccgcgcccccgagtggccgcgccgcgcctcctgcgcctcttcca
ccagcgggagcaagcgcggctccgtggacacagcgccctccagctcaatcagcactccca
gcgagcccctcagccccgccagctccctgggcgaggagcgcaactaagtcccgccgcccc
acactccccgcccatcctgcctcgctcgtccagagggcggacgcagaatggcactgttcc
gaaaccccactccacatcccgaacccgccttggggtccgcagccccgtcccctccgccgc
acactccagcccttctag

DBGET integrated database retrieval system