KEGG   Panthera tigris altaica (Amur tiger): 102950221
Entry
102950221         CDS       T02988                                 

Gene name
BCL2L1
Definition
(RefSeq) BCL2 like 1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01521  EGFR tyrosine kinase inhibitor resistance
ptg01524  Platinum drug resistance
ptg04014  Ras signaling pathway
ptg04064  NF-kappa B signaling pathway
ptg04115  p53 signaling pathway
ptg04137  Mitophagy - animal
ptg04140  Autophagy - animal
ptg04151  PI3K-Akt signaling pathway
ptg04210  Apoptosis
ptg04215  Apoptosis - multiple species
ptg04621  NOD-like receptor signaling pathway
ptg04630  JAK-STAT signaling pathway
ptg05012  Parkinson disease
ptg05014  Amyotrophic lateral sclerosis
ptg05022  Pathways of neurodegeneration - multiple diseases
ptg05145  Toxoplasmosis
ptg05162  Measles
ptg05166  Human T-cell leukemia virus 1 infection
ptg05168  Herpes simplex virus 1 infection
ptg05170  Human immunodeficiency virus 1 infection
ptg05200  Pathways in cancer
ptg05202  Transcriptional misregulation in cancer
ptg05212  Pancreatic cancer
ptg05220  Chronic myeloid leukemia
ptg05222  Small cell lung cancer
ptg05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102950221 (BCL2L1)
   04630 JAK-STAT signaling pathway
    102950221 (BCL2L1)
   04064 NF-kappa B signaling pathway
    102950221 (BCL2L1)
   04151 PI3K-Akt signaling pathway
    102950221 (BCL2L1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102950221 (BCL2L1)
   04137 Mitophagy - animal
    102950221 (BCL2L1)
  09143 Cell growth and death
   04210 Apoptosis
    102950221 (BCL2L1)
   04215 Apoptosis - multiple species
    102950221 (BCL2L1)
   04115 p53 signaling pathway
    102950221 (BCL2L1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102950221 (BCL2L1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102950221 (BCL2L1)
   05202 Transcriptional misregulation in cancer
    102950221 (BCL2L1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102950221 (BCL2L1)
   05225 Hepatocellular carcinoma
    102950221 (BCL2L1)
   05220 Chronic myeloid leukemia
    102950221 (BCL2L1)
   05222 Small cell lung cancer
    102950221 (BCL2L1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    102950221 (BCL2L1)
   05014 Amyotrophic lateral sclerosis
    102950221 (BCL2L1)
   05022 Pathways of neurodegeneration - multiple diseases
    102950221 (BCL2L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102950221 (BCL2L1)
   05170 Human immunodeficiency virus 1 infection
    102950221 (BCL2L1)
   05162 Measles
    102950221 (BCL2L1)
   05168 Herpes simplex virus 1 infection
    102950221 (BCL2L1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102950221 (BCL2L1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102950221 (BCL2L1)
   01524 Platinum drug resistance
    102950221 (BCL2L1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ptg01009]
    102950221 (BCL2L1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ptg03036]
    102950221 (BCL2L1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ptg02000]
    102950221 (BCL2L1)
Protein phosphatases and associated proteins [BR:ptg01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102950221 (BCL2L1)
Chromosome and associated proteins [BR:ptg03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    102950221 (BCL2L1)
Transporters [BR:ptg02000]
 Other transporters
  Pores ion channels [TC:1]
   102950221 (BCL2L1)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 102950221
NCBI-ProteinID: XP_007073601
LinkDB
Position
Un
AA seq 233 aa
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
NT seq 702 nt   +upstreamnt  +downstreamnt
atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa
ggatacagctggagtcagtttagtgatgtggaagagaacagaactgaggccccagaaggg
actgaatcggagatggagacccccagtgccatcaatggcaacccatcctggcacttggcg
gacagccctgcggtgaatggagccactggccacagcagcagcttggatgcccgggaggtg
atccccatggcagcggtgaagcaggcgctgagggaggccggggatgagtttgaactgagg
taccggcgggcattcagcgacctgacatcccagcttcacatcaccccagggacagcatat
cagagctttgagcaggtagtgaacgaactcttccgggatggggtgaactggggtcgcatt
gtggcctttttctccttcggtggggcactgtgcgtggaaagcgtagacaaggagatgcag
gtattggtgagtcggatcgcaacttggatggccacttacctgaacgaccacctagagcct
tggatccaggagaacggcggctgggacacttttgtggaactctacgggaacaatgcagcg
gccgagagccggaagggccaggagcgcttcaaccgctggttcctgacaggcatgactgtg
gctggcgtggttctgctgggctcactcttcagtcggaaatga

DBGET integrated database retrieval system