Panthera tigris altaica (Amur tiger): 102950221 Help Entry 102950221         CDS       T02988                                  Gene name BCL2L1 Definition (RefSeq) BCL2 like 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg01521   EGFR tyrosine kinase inhibitor resistance ptg01524   Platinum drug resistance ptg04014   Ras signaling pathway ptg04064   NF-kappa B signaling pathway ptg04115   p53 signaling pathway ptg04137   Mitophagy - animal ptg04140   Autophagy - animal ptg04151   PI3K-Akt signaling pathway ptg04210   Apoptosis ptg04215   Apoptosis - multiple species ptg04621   NOD-like receptor signaling pathway ptg04630   JAK-STAT signaling pathway ptg05012   Parkinson disease ptg05014   Amyotrophic lateral sclerosis ptg05022   Pathways of neurodegeneration - multiple diseases ptg05145   Toxoplasmosis ptg05162   Measles ptg05166   Human T-cell leukemia virus 1 infection ptg05168   Herpes simplex virus 1 infection ptg05170   Human immunodeficiency virus 1 infection ptg05200   Pathways in cancer ptg05202   Transcriptional misregulation in cancer ptg05212   Pancreatic cancer ptg05220   Chronic myeloid leukemia ptg05222   Small cell lung cancer ptg05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:ptg00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     102950221 (BCL2L1)    04630 JAK-STAT signaling pathway     102950221 (BCL2L1)    04064 NF-kappa B signaling pathway     102950221 (BCL2L1)    04151 PI3K-Akt signaling pathway     102950221 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102950221 (BCL2L1)    04137 Mitophagy - animal     102950221 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     102950221 (BCL2L1)    04215 Apoptosis - multiple species     102950221 (BCL2L1)    04115 p53 signaling pathway     102950221 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     102950221 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102950221 (BCL2L1)    05202 Transcriptional misregulation in cancer     102950221 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     102950221 (BCL2L1)    05225 Hepatocellular carcinoma     102950221 (BCL2L1)    05220 Chronic myeloid leukemia     102950221 (BCL2L1)    05222 Small cell lung cancer     102950221 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     102950221 (BCL2L1)    05014 Amyotrophic lateral sclerosis     102950221 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     102950221 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102950221 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     102950221 (BCL2L1)    05162 Measles     102950221 (BCL2L1)    05168 Herpes simplex virus 1 infection     102950221 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102950221 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     102950221 (BCL2L1)    01524 Platinum drug resistance     102950221 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ptg01009]     102950221 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ptg03036]     102950221 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:ptg02000]     102950221 (BCL2L1) Protein phosphatases and associated proteins [BR:ptg01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      102950221 (BCL2L1) Chromosome and associated proteins [BR:ptg03036]  Eukaryotic type   Centrosome formation and ciliogenesis proteins    Other centriole associated proteins     102950221 (BCL2L1) Transporters [BR:ptg02000]  Other transporters   Pores ion channels [TC:1]    102950221 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  102950221 NCBI-ProteinID:  XP_007073601 LinkDB All DBs Position Un AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa ggatacagctggagtcagtttagtgatgtggaagagaacagaactgaggccccagaaggg actgaatcggagatggagacccccagtgccatcaatggcaacccatcctggcacttggcg gacagccctgcggtgaatggagccactggccacagcagcagcttggatgcccgggaggtg atccccatggcagcggtgaagcaggcgctgagggaggccggggatgagtttgaactgagg taccggcgggcattcagcgacctgacatcccagcttcacatcaccccagggacagcatat cagagctttgagcaggtagtgaacgaactcttccgggatggggtgaactggggtcgcatt gtggcctttttctccttcggtggggcactgtgcgtggaaagcgtagacaaggagatgcag gtattggtgagtcggatcgcaacttggatggccacttacctgaacgaccacctagagcct tggatccaggagaacggcggctgggacacttttgtggaactctacgggaacaatgcagcg gccgagagccggaagggccaggagcgcttcaaccgctggttcctgacaggcatgactgtg gctggcgtggttctgctgggctcactcttcagtcggaaatga

DBGET integrated database retrieval system