KEGG   Panthera tigris altaica (Amur tiger): 102950263
Entry
102950263         CDS       T02988                                 

Gene name
RRM2
Definition
(RefSeq) ribonucleotide reductase regulatory subunit M2
  KO
K10808  ribonucleoside-diphosphate reductase subunit M2 [EC:1.17.4.1]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00230  Purine metabolism
ptg00240  Pyrimidine metabolism
ptg00480  Glutathione metabolism
ptg00983  Drug metabolism - other enzymes
ptg01100  Metabolic pathways
ptg04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102950263 (RRM2)
   00240 Pyrimidine metabolism
    102950263 (RRM2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102950263 (RRM2)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    102950263 (RRM2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102950263 (RRM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ptg03400]
    102950263 (RRM2)
Enzymes [BR:ptg01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     102950263 (RRM2)
DNA repair and recombination proteins [BR:ptg03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    102950263 (RRM2)
SSDB
Motif
Pfam: Ribonuc_red_sm
Other DBs
NCBI-GeneID: 102950263
NCBI-ProteinID: XP_007098285
LinkDB
Position
Un
AA seq 351 aa
MAISCGTPYNSYFHYPLARQKTKVLVPSVEDEPLLRENPRRFVIFPIEYHDIWQMYKKAE
ASFWTAEEVDLSKDIQHWESLKAEERYFISHVLAFFAASDGIVNENLVERFSQEVQITEA
RCFYGFQIAMENIHSEMYSLLIDTYIKDPREREFLFNAIETMPCVKKKADWALRWIGDKE
STYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFK
HLVHKPSEQRVKEIIINAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFG
KVFRVENPFDFMENISLEGKTNFFEKRVGEYQRMGVMSSPTENSFTLDADF
NT seq 1056 nt   +upstreamnt  +downstreamnt
atggcaatttcatgtgggacgccctacaattcgtatttccattaccccctcgcccggcag
aaaactaaggtgcttgtccccagcgtggaggatgagccactgctccgagaaaaccctcgt
cgctttgtcatctttcctatcgagtaccatgatatttggcagatgtataagaaagcggag
gcttccttctggacagccgaagaggtggatctttccaaggacattcagcactgggagtcc
ctgaaggcagaggagagatattttatatcgcatgttctggctttctttgcagcgagtgat
ggcatagtaaatgagaacttggtggagcggtttagccaagaagttcagattactgaagcc
cgctgtttctacggcttccaaattgccatggaaaacatccattctgagatgtatagtctc
ctcattgacacttacattaaagatcccagagagagggaatttctcttcaacgccatcgag
acgatgccttgtgtaaagaagaaggcggattgggccttgcgttggattggcgacaaagag
tctacctacggagagcgggttgtggcctttgctgcagtggaaggaatcttcttttctggt
tctttcgcgtcgatattctggctcaagaaacgcggcctgatgcctggcctcacgttttcc
aatgaacttattagcagagatgagggtctacactgtgactttgcctgcctgatgttcaaa
cacctggtccacaagccttcagagcagagagtgaaggaaattattatcaatgccgttagg
atagaacaggaattcctcacggaggccttgccagtgaaactaattgggatgaattgcact
ttaatgaagcagtatattgaattcgtggcagacagacttatgctggagctaggttttggc
aaggttttcagagtagaaaatccatttgactttatggagaatatttcactggaagggaag
actaacttctttgagaagagagtaggcgagtatcagaggatgggagtgatgtcaagtcca
acagagaattcttttaccttggatgctgacttctaa

KEGG   Panthera tigris altaica (Amur tiger): 102950840
Entry
102950840         CDS       T02988                                 

Gene name
RRM2B
Definition
(RefSeq) ribonucleotide reductase regulatory TP53 inducible subunit M2B
  KO
K10808  ribonucleoside-diphosphate reductase subunit M2 [EC:1.17.4.1]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00230  Purine metabolism
ptg00240  Pyrimidine metabolism
ptg00480  Glutathione metabolism
ptg00983  Drug metabolism - other enzymes
ptg01100  Metabolic pathways
ptg04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102950840 (RRM2B)
   00240 Pyrimidine metabolism
    102950840 (RRM2B)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102950840 (RRM2B)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    102950840 (RRM2B)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102950840 (RRM2B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ptg03400]
    102950840 (RRM2B)
Enzymes [BR:ptg01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     102950840 (RRM2B)
DNA repair and recombination proteins [BR:ptg03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    102950840 (RRM2B)
SSDB
Motif
Pfam: Ribonuc_red_sm
Other DBs
NCBI-GeneID: 102950840
NCBI-ProteinID: XP_007075869
LinkDB
Position
Un
AA seq 351 aa
MGDPERPEAARPELGERLSSDSNENEVKSNEEPLLRKSSRRFVIFPIQYPDIWKMYKKAQ
ASFWTAEEVDLSKDLPHWNKLKSDEKYFISHILAFFAASDGIVNENLVERFSQEVQVPEA
RCFYGFQILIENVHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRK
STFGKXVVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQ
YLVNKPSEERVREIIVNAVEIEQEFLTEALPVGLIGMNCVLMKQYIEFVADRLLVELGFS
KVFQAENPFDFMENISLEGKTNFFEKRVAEYQRFAVMAETTDNVFTLDADF
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgggtgacccggaaaggccggaagcggccaggcccgagctgggtgagaggttgtcttca
gattccaatgaaaatgaagtgaagtcaaatgaagagccactcctacgaaagagttctcgc
cgatttgtcatctttccaatccagtaccctgacatttggaaaatgtataaaaaggcacag
gcatccttctggacagcagaagaggttgacttatcaaaggatctccctcactggaacaag
cttaaatctgatgagaagtattttatctctcacatattagccttttttgcagccagtgat
ggcattgtgaacgaaaatttggtggagcgctttagtcaggaggttcaggttccagaggct
cgctgtttctatggctttcaaattctcatcgagaatgttcactcagagatgtacagtttg
ctaatagacacgtacatcagagatcccaagaaaagggaatttttatttaatgcaattgaa
acaatgccatatgttaagaaaaaggcagattgggccctacgatggatagcagatagaaaa
tcgacttttggtaagtaagtggtggcttttgcagctgtagaagggattttcttctcagga
tcttttgctgctatattctggctgaagaaaagaggtcttatgcctggactcactttttcc
aatgaactcatcagcagagatgaaggacttcactgtgactttgcttgcctgatgtttcaa
tacttagtaaataagccatcagaagaaagggtcagggagatcattgttaatgctgttgaa
attgagcaggagtttctaacagaagccttgccagttggcctcattggaatgaattgtgtt
ttgatgaaacaatatattgagtttgtagctgacagattacttgtggaacttggattctca
aaggtttttcaggcagaaaatccctttgattttatggaaaacatttctttggaagggaaa
acaaatttctttgagaaacgagttgcagagtatcaacgttttgcagttatggcagaaact
acagataatgtcttcaccctggatgcagatttttag

KEGG   Panthera tigris altaica (Amur tiger): 102953329
Entry
102953329         CDS       T02988                                 

Gene name
RRM1
Definition
(RefSeq) ribonucleotide reductase catalytic subunit M1
  KO
K10807  ribonucleoside-diphosphate reductase subunit M1 [EC:1.17.4.1]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00230  Purine metabolism
ptg00240  Pyrimidine metabolism
ptg00480  Glutathione metabolism
ptg00983  Drug metabolism - other enzymes
ptg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102953329 (RRM1)
   00240 Pyrimidine metabolism
    102953329 (RRM1)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102953329 (RRM1)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    102953329 (RRM1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ptg03400]
    102953329 (RRM1)
Enzymes [BR:ptg01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     102953329 (RRM1)
DNA repair and recombination proteins [BR:ptg03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    102953329 (RRM1)
SSDB
Motif
Pfam: Ribonuc_red_lgC Ribonuc_red_lgN ATP-cone
Other DBs
NCBI-GeneID: 102953329
NCBI-ProteinID: XP_007089425
LinkDB
Position
Un
AA seq 792 aa
MHVIKRDGRQERVMFDKITSRIQKLCYGLNMDFVDPAQITMKVIQGLYSGVTTVELDTLA
AETAATLTTKHPDYAILAARIAVSNLHKETKKVFSDVMEDLYNYINPHNGKHSPMVAKST
LDIVLANKDRLNSAIIYDRDFSYNYFGFKTLERSYLLKINGKVAERPQHMLMRVSVGIHE
EDIDAAIETYNLLSEKWFTHASPTLFNAGTNRPQLSSCFLLSMKDDSIEGIYDTLKQCAL
ISKSAGGIGVAVSCIRATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGNKRPGAFAIY
LEPWHLDIFEFLDLKKNTGKEEQRARDLFFALWIPDLFMKRVETNQDWSLMCPNECPGLD
EVWGEEFEKLYESYEKQGRVRKVVKAQQLWYAIIESQTETGTPYMFYKDSCNRKSNQQNL
GKIKCSNLCTEIVEYTSKDEVAVCNLASLALNMYVTSEHTYDFKKLAEVTKVIVRNLNKI
IDINYYPVPEACLSNKRHRPIGIGVQGLADAFILMRYPFESPEAQLLNKQIFETIYYGAL
EASCDLAKEHGPYETYEGSPVSKGILQYDMWNVIPTDLWDWKLLKEKIAKYGIRNSLLIA
PMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWNEEMKNQII
ACNGSIQNIPEIPDDLKQLYKTVWEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKL
TSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKATKEEEEKERNTAAMVCS
LENREECLMCGS
NT seq 2379 nt   +upstreamnt  +downstreamnt
atgcatgtgatcaagcgcgatggccgccaagagcgggttatgttcgacaaaattacgtct
cgaatccagaagctatgttatggacttaatatggattttgttgaccctgctcagatcacc
atgaaagtaatccagggcttatacagtggggtcaccactgtggaactagatactttggct
gctgaaacagctgcgaccttgactaccaagcaccctgactatgccatcctggcagcaagg
attgcggtctccaacttgcacaaagaaacaaagaaagtgttcagtgatgtgatggaagat
ctctacaactacataaatccacataatggcaaacactctcccatggtggccaagtcaaca
ctggatattgttttggccaataaagatcgcctgaattctgccattatctatgaccgagat
ttctcttataattactttggatttaagactctggagcggtcctatttgttgaagatcaat
ggaaaagtggctgaaagaccacagcatatgttgatgagggtatctgtggggattcatgaa
gaagatattgatgctgctattgaaacatataatcttctttctgagaagtggtttacccat
gcctctcccactctcttcaatgctggtaccaaccgcccacagctttctagttgcttcctt
ctgagtatgaaagatgatagtattgaaggcatttatgacactctaaagcagtgtgcattg
atttccaagtctgctggtggaattggtgtcgctgtgagttgtattcgagctactggcagc
tacattgctgggactaatggcaattccaatggccttgtgccaatgctgagagtatataac
aacacagctcgatatgtggatcaaggtggaaacaagcgacctggggcatttgctatttat
ctggagccttggcatttagacatttttgagtttcttgatttaaagaagaacacaggaaag
gaagaacagcgtgccagagaccttttctttgccctttggattccggatctcttcatgaaa
cgagtggagactaatcaggactggtctttgatgtgtccaaatgaatgtcctggtctggat
gaggtttggggagaggaatttgagaagctgtatgaaagttatgagaaacagggtcgtgtc
cgcaaagttgtaaaagctcagcagctttggtatgccatcattgagtctcagacagagaca
ggtaccccgtacatgttctacaaagattcatgtaatcggaagagcaaccagcagaacctg
ggaaaaatcaaatgcagcaacctgtgcacagaaatagtagagtataccagcaaagatgag
gttgcagtctgtaacttggcttccctagccctgaatatgtatgtcacgtcagaacacaca
tatgactttaagaagttggctgaagttacaaaagtcattgtccgaaacttgaataaaatt
attgatattaattactaccctgtcccagaggcatgcttatcaaataaacgccatcgcccc
attggaatcggggtacaaggtctggcagatgcttttattctgatgaggtatccttttgag
agtccagaagcccagttactaaacaagcaaatctttgaaactatttattatggagccttg
gaagccagctgtgacctggccaaggagcatggcccatatgaaacctatgagggctctcca
gtcagcaaaggaatccttcagtatgatatgtggaatgttattcccacagacctatgggac
tggaaacttctcaaggaaaagattgcaaagtatggtataagaaacagtttacttattgcc
ccaatgcctactgcttcaactgctcagattctgggaaataatgagtccatcgaaccttat
accagcaacatctatactcgcagagtcttgtcgggagaatttcagattgtaaatccgcac
ttactgaaggatcttaccgagcggggcttgtggaatgaagagatgaaaaatcagattatt
gcatgcaatggttctatccagaacataccagaaattcctgatgacctgaagcaactttat
aagactgtgtgggagatctcacagaaaaccgttcttaagatggcagctgaaagaggtgct
ttcattgatcaaagccagtctttgaacatccacattgctgagcctaactatggcaaactc
actagtatgcacttctacggctggaagcagggtttgaagactggaatgtattacttaagg
acacgaccagcagcgaatccaatccagttcactctaaataaggagaagctgaaagataag
gagaaggcaacaaaagaagaagaagagaaggagaggaacacagcagccatggtgtgctct
ttggagaatagagaagagtgtctgatgtgtgggtcctga

DBGET integrated database retrieval system