KEGG   Panthera tigris altaica (Amur tiger): 102950357Help
Entry
102950357         CDS       T02988                                 

Gene name
SOD2
Definition
(RefSeq) superoxide dismutase 2
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04068  FoxO signaling pathway
ptg04146  Peroxisome
ptg04211  Longevity regulating pathway
ptg04213  Longevity regulating pathway - multiple species
ptg05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102950357 (SOD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102950357 (SOD2)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway - mammal
    102950357 (SOD2)
   04213 Longevity regulating pathway - multiple species
    102950357 (SOD2)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05016 Huntington disease
    102950357 (SOD2)
Enzymes [BR:ptg01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     102950357 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 102950357
NCBI-ProteinID: XP_015399782
LinkDB All DBs
Position
Un
AA seq 252 aa AA seqDB search
MCLFLGSLGPPKGAGWRRERRRRATRERIGACVCSLSSSSRTLVPALGALGSRQKHSLPD
LPYDYGALEPHINAQIMQLHHSKHHATYVNNLNVLEERYREALEKGDVTTQVALQPGLKF
NGGGHINHSIFWTNLSPKGGGEPKGELLEAIKRDFGSFDKFKEKLTTVSVGVQGSGWGWL
GFNKEQGRLQIAACFNQDPLEGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINW
ENVTERYMACKK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtgcctctttctcgggtccctggggcccccaaagggggcgggctggcgcagggagcgg
agacggcgcgctacacgtgagcgaatcggtgcgtgtgtctgctctctttccagctcgagc
aggacgctggtgccggcgctgggggctctgggttccaggcagaagcacagcctccccgac
ttgccgtacgattatggcgccctggagcctcacatcaacgcccagatcatgcagctgcac
cacagcaagcaccacgcgacctacgtgaacaacctgaacgtcctcgaggagcggtatcga
gaggcgctggagaagggtgacgttacaactcaggtagctcttcagcctgggctgaagttc
aatggtggaggccatatcaatcattccatcttctggacgaacctgagccctaagggtggt
ggagagcccaaaggggaattgctggaagccatcaaacgtgattttggttccttcgacaag
tttaaagagaagttgaccactgtatctgttggcgtccaaggctcaggttggggttggctt
ggtttcaataaggaacagggacgcttgcagattgctgcttgttttaaccaggatcccctg
gaaggaacaacaggtcttattccactgctggggattgatgtgtgggagcatgcttattac
cttcagtataaaaatgtcagaccggattatctaaaagctatttggaatgtaatcaactgg
gagaacgtaactgagagatacatggcttgcaaaaagtaa

DBGET integrated database retrieval system