KEGG   Panthera tigris altaica (Amur tiger): 102950505
Entry
102950505         CDS       T02988                                 

Gene name
BIRC5
Definition
(RefSeq) baculoviral IAP repeat containing 5
  KO
K08731  baculoviral IAP repeat-containing protein 5
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01524  Platinum drug resistance
ptg04210  Apoptosis
ptg04215  Apoptosis - multiple species
ptg04390  Hippo signaling pathway
ptg05161  Hepatitis B
ptg05200  Pathways in cancer
ptg05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    102950505 (BIRC5)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102950505 (BIRC5)
   04215 Apoptosis - multiple species
    102950505 (BIRC5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102950505 (BIRC5)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102950505 (BIRC5)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102950505 (BIRC5)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102950505 (BIRC5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ptg01002]
    102950505 (BIRC5)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ptg03036]
    102950505 (BIRC5)
Peptidases and inhibitors [BR:ptg01002]
 Peptidase inhibitors
  Family I32: IAP family
   102950505 (BIRC5)
Chromosome and associated proteins [BR:ptg03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CPC (chromosomal passenger complex)
     102950505 (BIRC5)
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    102950505 (BIRC5)
SSDB
Motif
Pfam: BIR
Other DBs
NCBI-GeneID: 102950505
NCBI-ProteinID: XP_015397237
LinkDB
Position
Un
AA seq 147 aa
MPRDGRQPPDLNRVSARRLRCRDGRFVVAPGLAALPQGPPHLYVQELAVLGGLRLSLSSP
LQMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEE
LTLSEFLKLDKERAKNKIEKADVQQCL
NT seq 444 nt   +upstreamnt  +downstreamnt
atgccccgcgacggccgccaacctccggatttgaatcgagtcagcgctcggcggttgcgg
tgtcgggatgggcgcttcgtcgttgcccccggcctggcagctctacctcaaggaccaccg
catctctacgttcaagaactggccgttcttggagggctgcgcctgagcctcagctctccc
ctgcagatggccgaggccggcttcatccactgtcccactgagaacgagcccgatttggct
cagtgtttcttctgcttcaaggagctggaaggctgggagccagacgatgaccccatagag
gaacataagaagcattcatctggttgtgcctttctttctgtcaagaagcagtttgaagaa
ttgaccctcagtgaatttttgaaactggacaaagagagagccaagaacaaaattgaaaaa
gctgatgttcaacagtgtctctga

KEGG   Panthera tigris altaica (Amur tiger): 102951731
Entry
102951731         CDS       T02988                                 

Gene name
BIRC3
Definition
(RefSeq) baculoviral IAP repeat-containing protein 3
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01524  Platinum drug resistance
ptg04064  NF-kappa B signaling pathway
ptg04120  Ubiquitin mediated proteolysis
ptg04210  Apoptosis
ptg04215  Apoptosis - multiple species
ptg04217  Necroptosis
ptg04390  Hippo signaling pathway
ptg04510  Focal adhesion
ptg04621  NOD-like receptor signaling pathway
ptg04668  TNF signaling pathway
ptg05132  Salmonella infection
ptg05145  Toxoplasmosis
ptg05168  Herpes simplex virus 1 infection
ptg05200  Pathways in cancer
ptg05202  Transcriptional misregulation in cancer
ptg05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102951731 (BIRC3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    102951731 (BIRC3)
   04064 NF-kappa B signaling pathway
    102951731 (BIRC3)
   04668 TNF signaling pathway
    102951731 (BIRC3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102951731 (BIRC3)
   04215 Apoptosis - multiple species
    102951731 (BIRC3)
   04217 Necroptosis
    102951731 (BIRC3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102951731 (BIRC3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102951731 (BIRC3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102951731 (BIRC3)
   05202 Transcriptional misregulation in cancer
    102951731 (BIRC3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    102951731 (BIRC3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102951731 (BIRC3)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102951731 (BIRC3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102951731 (BIRC3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102951731 (BIRC3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ptg01002]
    102951731 (BIRC3)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ptg04121]
    102951731 (BIRC3)
Peptidases and inhibitors [BR:ptg01002]
 Peptidase inhibitors
  Family I32: IAP family
   102951731 (BIRC3)
Ubiquitin system [BR:ptg04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    102951731 (BIRC3)
SSDB
Motif
Pfam: BIR CARD zf-C3HC4_3 Prok-RING_4 zf-RING_5 DUF2039
Other DBs
NCBI-GeneID: 102951731
NCBI-ProteinID: XP_015390272
LinkDB
Position
Un
AA seq 558 aa
MHKATSPEKGWSLCHPVRFVMNIGANSTLSSKLLKGGTVSGLKYDHSCELYRMSTFSAFP
AGAPVSERSLARAGFYYTGRKDRVRCFCCGLTLDNWKQGDSPLEKHRRLYPSCSFIQSLN
PVSASGAPSQPACPTHGPAPAPGALAGFYSLGPGDKVACFACGGRLSNWEPDDDALSEHL
RHFPFCPFAESRLQDALRCAVSNRSMQTHAARSRSFCSWPPSVPVHPEQLALAGFYYMGH
SDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEYLIRIKGHEFISQIQASHPCLLEQLL
STSDNTEDENAESPIVHFGPGESSSEDAVMMNTPVVKAALEMGFSRNLVKQTVQSKILTS
GENYKTVSDIVSDLLNAEDEIREEEKERATEEKESDDVSLIRKNRMALFQHLTSVLPILD
GLRTARVITEQEHSVITQKAQTSLQARLLIDAVLVKGSFAVTVFKNCLLEMDPVLYERFF
VQQDLKYVPTEDGSDLPVEEQLRRLQEERTCKVCLDREVSVVFIPCGHLAVCQDCAPPLR
KCPICRGPIKGTVRTFLW
NT seq 1677 nt   +upstreamnt  +downstreamnt
atgcacaaagctacctccccagagaaaggctggtccctttgccaccccgtccgtttcgtc
atgaacatcggagcaaacagcacattgtcatcaaagctgctgaaaggcggcaccgtgtcg
gggctgaaatacgaccactcgtgtgagctgtaccgaatgtccacgttctcggccttcccc
gccggcgcccctgtctcggagcggagcctggcccgggccgggttctactacacgggccgg
aaggacagggtccggtgcttctgctgcggcctgacgctggacaactggaagcagggggac
agtcccctggagaagcatcggaggctgtaccccagctgcagcttcatccagagtctgaat
ccggtgagcgcttcgggcgccccctctcagcccgcctgtcctacccacggacccgcccca
gcacccggcgccctagcggggttttactccctgggccctggggacaaggtggcctgcttc
gcctgcggggggagactgagtaactgggagccggacgacgacgccctgtcagagcacctg
agacacttccccttctgcccgttcgcagaaagccggcttcaggacgccttgcggtgcgcc
gtgtccaaccggagcatgcagacgcacgcggcccgctcccgaagcttctgcagctggccc
cccagcgtgcctgtgcaccccgagcagctggccctggctggcttctactacatggggcac
agtgatgacgtcaaatgcttctgctgcgacggtggactgcgctgctgggaatcaggagac
gacccgtgggtggagcacgccaagtggtttccaaggtgtgagtatttgatacgaatcaaa
ggacacgagttcatcagtcagattcaagccagtcacccctgtctccttgaacagttgtta
tctacttcagacaacacagaagatgagaatgctgagtcaccaattgttcattttgggcct
ggagaaagttcctccgaagatgccgtcatgatgaacacacccgtggtgaaagcggccttg
gagatgggcttcagtagaaacctggtgaagcagaccgttcagagcaagatcctgacgagc
ggggagaattacaaaacagtcagtgatattgtatcagatttactcaatgcagaagatgaa
atcagggaagaggagaaagaaagagccactgaggaaaaagaatcagatgatgtgtcatta
atccggaagaacagaatggcgctctttcaacatctgacttccgtactccccatcctggat
ggtctccgaactgccagagtgattactgagcaagaacacagtgttattacacagaaagca
caaacatctctgcaagcaagattgctgattgatgctgtgttagtgaagggaagttttgca
gtcaccgtatttaaaaactgtctcctagaaatggaccccgtgttatacgagcgtttcttc
gtgcaacaggacctaaagtatgttcccacagaagatggttcagatttgccagtggaagag
cagctgaggaggctgcaggaggaaagaacctgcaaagtgtgcctggaccgagaagtgtcc
gtggtgttcattccctgcggccacctggcggtgtgccaagactgcgcccctcccctcaga
aaatgccccatttgcaggggcccaatcaagggcaccgtgcggacctttctgtggtga

KEGG   Panthera tigris altaica (Amur tiger): 102957920
Entry
102957920         CDS       T02988                                 

Gene name
XIAP
Definition
(RefSeq) X-linked inhibitor of apoptosis
  KO
K04725  E3 ubiquitin-protein ligase XIAP [EC:2.3.2.27]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01524  Platinum drug resistance
ptg04064  NF-kappa B signaling pathway
ptg04120  Ubiquitin mediated proteolysis
ptg04210  Apoptosis
ptg04215  Apoptosis - multiple species
ptg04217  Necroptosis
ptg04510  Focal adhesion
ptg04621  NOD-like receptor signaling pathway
ptg05145  Toxoplasmosis
ptg05166  Human T-cell leukemia virus 1 infection
ptg05200  Pathways in cancer
ptg05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102957920 (XIAP)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    102957920 (XIAP)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102957920 (XIAP)
   04215 Apoptosis - multiple species
    102957920 (XIAP)
   04217 Necroptosis
    102957920 (XIAP)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102957920 (XIAP)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102957920 (XIAP)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102957920 (XIAP)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    102957920 (XIAP)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102957920 (XIAP)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102957920 (XIAP)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102957920 (XIAP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ptg01002]
    102957920 (XIAP)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ptg04121]
    102957920 (XIAP)
   03029 Mitochondrial biogenesis [BR:ptg03029]
    102957920 (XIAP)
Enzymes [BR:ptg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     102957920 (XIAP)
Peptidases and inhibitors [BR:ptg01002]
 Peptidase inhibitors
  Family I32: IAP family
   102957920 (XIAP)
Ubiquitin system [BR:ptg04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    102957920 (XIAP)
Mitochondrial biogenesis [BR:ptg03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    102957920 (XIAP)
SSDB
Motif
Pfam: BIR zf-C3HC4_3 Prok-RING_4 zf-C3HC4_2 zf-RING_UBOX DUF2039
Other DBs
NCBI-GeneID: 102957920
NCBI-ProteinID: XP_007091769
LinkDB
Position
Un
AA seq 497 aa
MTFNSFEASKPCVPADLSKDEDFVEEFNRLKTFTNFPSNSPVSASTLARAGFLYTGEGDT
VRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYFESHAAQPTNPGIQNGQYKAENY
LGNRNHFVVDRPSETHADYLLRTGQVVDISDTIYPRNPAMYSEEARLKSFQNWPDYAHLT
PRELASAGLYYTGIEDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNVNVRSE
SDVVSSDRNFPNSTNAPRNPAMADYEARIVTFGTWMYSVNKEQLARAGFYALGEGDKVKC
FHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEEKGQDYVTNIHLTHSLEDSMVRAAEKMP
SLTKRIDDAIFQDPMVQQAIRMGFNFRDIKKVMEEKIQTSGSNYKSLEILVTDLVSAQKD
NTQDEPSQTSLQKEISAEEQLRLLQEEKLCKICMDRNIAVVFIPCGHLVTCKQCAEAVDK
CPMCYTIITFKQKIFMS
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgacttttaacagttttgaagcatctaaaccttgtgtacctgcagatctcagtaaggat
gaagactttgtagaagagtttaatagattaaagactttcactaattttccaagtaatagt
cctgtctcggcatcaacgctggcacgagcgggttttctgtatactggcgaaggagacact
gtgcgctgcttcagctgccacgcagcagtagatagatggcaatatggagactcagcggtt
ggacgacacaggaaagtatccccaaattgcagatttatcaatggcttttattttgaaagt
catgctgcgcaacctacaaaccctggtatccaaaatggtcagtataaagctgaaaactat
ctgggaaacagaaatcattttgttgtagacaggccatctgagactcacgcagactatctt
ttgagaactgggcaggttgtagatatatcagacaccatatacccgaggaaccccgccatg
tatagtgaagaagctagattaaagtcgtttcagaactggccagactatgcccacctgacc
ccacgagagttagctagcgctggactctactacacaggtattgaggatcaagtgcagtgc
ttttgttgtggcggaaaactgaaaaattgggaaccttgcgatcgtgcatggtcagaacac
aggcggcactttcctaattgcttctttgttttgggccggaatgtgaatgttcgaagtgaa
tctgatgttgtgagttctgataggaatttcccaaactcgacaaatgctccaagaaatcca
gccatggcagattatgaagcacggatcgttacttttgggacgtggatgtactccgttaac
aaggagcagcttgccagagctggattttatgctttaggggaaggtgataaagtaaaatgc
tttcactgtggaggagggctaactgattggaagcccagtgaagacccttgggaacaacat
gctaagtggtatccagggtgtaaatatctgttagaagagaagggacaagactatgtaacc
aatattcatttaacccattcacttgaggactctatggtaagagctgctgaaaaaatgcca
tcattaaccaaaagaattgatgatgccatcttccaagatcctatggtacagcaagctata
cgaatgggattcaatttcagagacattaagaaagtaatggaagaaaaaattcagacatct
gggagcaactataaatcacttgagattctggttacagacctagtgagtgctcagaaagac
aatacgcaggatgaaccaagccagacctcattgcagaaagagattagtgccgaagagcag
ctaaggctcctgcaagaggagaagctttgcaaaatctgtatggatagaaatattgctgtg
gtttttattccttgtggacatctggtcacttgtaaacaatgtgctgaagcagttgacaaa
tgtcccatgtgctacacaatcattactttcaagcaaaaaatttttatgtcttaa

KEGG   Panthera tigris altaica (Amur tiger): 102972419
Entry
102972419         CDS       T02988                                 

Gene name
BIRC2
Definition
(RefSeq) baculoviral IAP repeat containing 2
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01524  Platinum drug resistance
ptg04064  NF-kappa B signaling pathway
ptg04120  Ubiquitin mediated proteolysis
ptg04210  Apoptosis
ptg04215  Apoptosis - multiple species
ptg04217  Necroptosis
ptg04390  Hippo signaling pathway
ptg04510  Focal adhesion
ptg04621  NOD-like receptor signaling pathway
ptg04668  TNF signaling pathway
ptg05132  Salmonella infection
ptg05145  Toxoplasmosis
ptg05168  Herpes simplex virus 1 infection
ptg05200  Pathways in cancer
ptg05202  Transcriptional misregulation in cancer
ptg05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102972419 (BIRC2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    102972419 (BIRC2)
   04064 NF-kappa B signaling pathway
    102972419 (BIRC2)
   04668 TNF signaling pathway
    102972419 (BIRC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102972419 (BIRC2)
   04215 Apoptosis - multiple species
    102972419 (BIRC2)
   04217 Necroptosis
    102972419 (BIRC2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102972419 (BIRC2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102972419 (BIRC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102972419 (BIRC2)
   05202 Transcriptional misregulation in cancer
    102972419 (BIRC2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    102972419 (BIRC2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102972419 (BIRC2)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102972419 (BIRC2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102972419 (BIRC2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102972419 (BIRC2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ptg01002]
    102972419 (BIRC2)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ptg04121]
    102972419 (BIRC2)
Peptidases and inhibitors [BR:ptg01002]
 Peptidase inhibitors
  Family I32: IAP family
   102972419 (BIRC2)
Ubiquitin system [BR:ptg04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    102972419 (BIRC2)
SSDB
Motif
Pfam: BIR CARD zf-C3HC4_3 Prok-RING_4 zf-C3HC4_2 DUF2039 zf-RING_UBOX
Other DBs
NCBI-GeneID: 102972419
NCBI-ProteinID: XP_007076032
LinkDB
Position
Un
AA seq 619 aa
MHKTTSQRLVPGSSCQRIKSTMEDSTIFANRTVGSKQRIQYDLSCELYRMSTYSTFPAGV
PVSERSLARAGFYYTGVKDKVRCFCCGLMLDNWKHGDSPIEKHKQLYPSCSFIHSLVSLT
SLESTSKSASPMRNSFPHLLSPTLEHGGTFSGSHSNLSPNPVNSRALEDFSPLRTNPYSY
AMSTEEARFLTYHMWPLTFLSPSELARAGFYYIGPGDKVACFACGGTLSNWEPKDDALSE
HRRHFPNCPFLENSLETLRFSISNLSMQTHAARLRTFVCWPSSVPVQPEQLASAGFYYVG
RNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLIRMKGQDFVDEIQARYPHLLEQL
LSTSDTPGDENTDPPIVHFGPGESSSEDAVMMNTPVVKAALEMGFSRNLVKQTVQSKILT
SGENYKTVSDIVLALLDAEDETREEEKERQTEELASDDLSLIRRNRMALFQQLMCVLPIL
DNLLKANVINKQEHDIIKQKTQIPLQARELIDTVLVKGNAAANIFKSCLKEIDPTLYKNL
FVDKNMKYVPTEDVSGLSLEEQLRRLQEERTCKVCLDREVSVVFIPCGHLVVCQDCAPSL
RKCPICRGIIKGTVRTFLS
NT seq 1860 nt   +upstreamnt  +downstreamnt
atgcacaaaactacttcccagagactcgtgccaggttcttcttgtcagagaattaagagc
acgatggaagatagcacgatcttcgcaaatcggacagtcggcagcaaacaaagaatacag
tatgacctttcatgtgaactgtataggatgtccacgtattcgacgtttcccgccggtgtt
cccgtctcagaaaggagtctcgcgcgtgctgggttttactacactggtgtgaaggacaag
gttagatgcttctgctgtggcctgatgctggacaactggaagcatggagacagtcctatt
gaaaagcacaaacagctgtatcccagctgtagtttcattcacagtctggtttctcttact
agtctggaatccacctctaagagtgcttctccaatgagaaacagttttccacatttgttg
tctcccactttggaacacggtggcacattcagtggttctcattccaacctttcaccaaac
cctgtgaattctagagcactcgaagacttctccccattgaggactaacccctacagttac
gcgatgagtactgaggaagctcgatttctgacttaccacatgtggccattaaccttcttg
tcaccctcagagttggcgagagccggcttctattacatagggcctggggacaaggtggcc
tgctttgcttgcggtggcactctcagtaactgggagccgaaggatgacgctctgtcagag
catcggagacattttcccaactgcccgtttctggaaaattctctggagacgctgaggttt
agcatttcaaacctgagcatgcagacgcacgcagctcggctgagaacgttcgtgtgctgg
ccgtcgagcgtcccggtccaacccgagcagctcgccagtgccggcttctattacgtgggt
cgcaatgatgacgtcaaatgcttttgttgtgatggtggcttaaggtgttgggagtctgga
gacgacccgtgggtggagcacgccaagtggtttccaaggtgtgagttcttgattcgcatg
aaggggcaggattttgttgatgagattcaagctcgataccctcaccttcttgagcagctt
ttgtcaacctcagatactcctggagatgaaaatactgatccaccaattgttcattttggg
cctggagaaagttcctccgaagatgccgtcatgatgaacacacccgtggtgaaagcggcc
ttggagatgggcttcagtagaaacctggtgaagcagaccgttcagagcaagatcctgacg
agcggggagaattacaaaacagtcagtgatattgtgttggcacttcttgatgctgaagat
gagaccagagaagaagagaaggaaagacaaactgaagagctggcatcagatgatctgtca
ttaattcggaggaacagaatggctctttttcaacagttgatgtgtgtgcttcctatcctg
gataatcttttaaaggccaatgtcattaataaacaggaacatgatattattaagcaaaaa
acacagatacctttgcaagcaagagaactgattgataccgttttggtcaaaggaaatgct
gctgccaacatcttcaaaagctgcttaaaagaaattgaccctacattatataagaactta
tttgtggacaagaacatgaagtatgttccaacagaagatgtttcaggtctgtcgctggaa
gagcagctgaggaggctgcaggaggaaagaacctgcaaagtgtgcctggaccgagaagtg
tccgtggtgttcattccctgcggccacctggtggtgtgccaagactgcgccccttccctc
agaaaatgccccatttgcaggggtataatcaagggcaccgtccggacctttctctcataa

DBGET integrated database retrieval system