KEGG   Panthera tigris altaica (Amur tiger): 102950564
Entry
102950564         CDS       T02988                                 

Gene name
ODC1
Definition
(RefSeq) ornithine decarboxylase 1
  KO
K01581  ornithine decarboxylase [EC:4.1.1.17]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00330  Arginine and proline metabolism
ptg00480  Glutathione metabolism
ptg01100  Metabolic pathways
Module
ptg_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    102950564 (ODC1)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102950564 (ODC1)
Enzymes [BR:ptg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.17  ornithine decarboxylase
     102950564 (ODC1)
SSDB
Motif
Pfam: Orn_Arg_deC_N Orn_DAP_Arg_deC AP_endonuc_2
Other DBs
NCBI-GeneID: 102950564
NCBI-ProteinID: XP_007098286
LinkDB
Position
Un
AA seq 461 aa
MNSFSNAEFDCHFLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHLRWLKALP
RVTPFYAVKCNDSRTIVKTLAAIGIGFDCASKTEIQLVQSLGVPPERIIYANPCKQVSQI
KYAANNGVQMMTFDSEVELMKVARAHPKAKLVLRIATDDSKAVCRLSVKFGATLKTSRLL
LERARELNIDVIGVSFHVGSGCTDPETFVQAISDARCVFDMGAEVGFNMCLLDIGGGFPG
SEDVKLKFEEITSVINPALDKYFPADSGVRVIAEPGRYYVASAFTLAVNIIAKKLVVKEQ
TGSDDEDESSEQTFMYYVNDGVYGSFNCILYDHAHVKPLLQKRPKPDEKYYSTSIWGPTC
DGLDRIVERCDLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPTIYYVMSGPTWQRMQQI
QNHDFPPEAEEQDASALPVSCARESGMKRPPAACASASINV
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgaacagctttagtaatgcagagtttgactgccatttcctcgatgaaggctttactgcc
aaggacattctggaccaaaaaatcaatgaagtctcctcttctgatgataaggatgccttc
tatgtcgcggatctgggagacattctaaagaaacatctgagatggttaaaagctcttcct
cgggtcacccccttttatgcagttaaatgcaacgatagcagaaccatagtgaagacccta
gctgccattgggataggattcgactgtgccagcaagactgaaatccaactggtgcagagt
ctcggggtgcctccggagaggatcatctatgcaaatccttgtaaacaagtgtctcagatt
aagtatgctgccaataacggagtccagatgatgactttcgacagtgaagtggagttgatg
aaagttgccagagctcacccaaaggcaaagttggttttgcggattgccaccgatgattcc
aaggcagtctgtcgcctcagtgttaaatttggtgccacactcaaaaccagcaggcttctt
ttggaacgggcgagggagctaaatattgatgtcatcggagtcagcttccacgtgggaagt
ggctgtaccgatcccgagaccttcgtgcaggccatctccgacgcccgctgtgtctttgac
atgggggctgaggttggtttcaacatgtgtctgctcgatatcggtggcggctttcctggg
tctgaggatgtaaagcttaaatttgaagagatcaccagtgtaatcaaccccgccctggac
aagtacttcccggcagactcgggggtgcgagtcatagctgagcccggcagatactacgtc
gcgtcggctttcacgcttgcagttaatatcattgcgaaaaagctcgtcgtaaaggaacag
acgggctctgatgatgaagatgaatcgagtgaacaaacctttatgtattacgtgaatgac
ggagtgtacggatcattcaattgcatcctttatgatcatgcacacgtgaagccccttttg
cagaagagacccaaaccagatgagaaatattactcaaccagcatatggggaccaacgtgt
gacggccttgatcgcatcgtcgagcgctgtgacttgcccgagatgcacgtgggcgattgg
atgctctttgaaaacatgggtgcttacactgttgctgctgcttctactttcaacgggttc
cagaggccaaccatctactacgtgatgtcggggccgacatggcaacggatgcagcagatc
cagaaccacgacttcccgcccgaagcggaggagcaggacgcgagcgcgctgcccgtgtcc
tgcgcccgggagagtgggatgaagcgccccccggccgcctgcgcctcggccagcattaac
gtgtag

KEGG   Panthera tigris altaica (Amur tiger): 102970178
Entry
102970178         CDS       T02988                                 

Definition
(RefSeq) antizyme inhibitor 2-like
  KO
K01581  ornithine decarboxylase [EC:4.1.1.17]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00330  Arginine and proline metabolism
ptg00480  Glutathione metabolism
ptg01100  Metabolic pathways
Module
ptg_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    102970178
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102970178
Enzymes [BR:ptg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.17  ornithine decarboxylase
     102970178
SSDB
Motif
Pfam: Orn_Arg_deC_N Orn_DAP_Arg_deC AP_endonuc_2
Other DBs
NCBI-GeneID: 102970178
NCBI-ProteinID: XP_007092570
LinkDB
Position
Un
AA seq 405 aa
MEGSVEGSGTSTPLGKPKESQGPPGSVWPKELIALEPGESAWQVALKKIQELSDSGHPDP
FMVADLGVLASHHRAFCQALPRVSPFYAVKCNSSVWVLRVLDTLGTGFDCASQATSEWRD
HRLLVLRLLTKDSESIFPLSTKFGASLEACERLLKSARDLGLAVVGTSFHVGSNCQTPHN
FRQAIADCRRVFEMGRAFGHDMSLLDIGGGFPGGEGCEPQFEEMARVINAALAQDFPEGS
GVEIIAEPGRFYAASVCMAAVNIIAKKAVLESGGRRKLLYYLNDGHYGTFRLCLREPVPR
MPIVVKELCSDPPLFPCTLYGPTCDAFDKLFREEVQLPELDVGDWLVFPSMGAYTSSMSS
TFNGFPPASTYYAMEPELSLCNGPPRPPESAPLGQHQRDLPASLD
NT seq 1218 nt   +upstreamnt  +downstreamnt
atggagggatctgttgaagggtcgggcaccagcaccccccttgggaagccgaaggagagt
caaggaccccctggaagcgtgtggccaaaggagctcatcgcactggagcctggggaatct
gcctggcaggtggccctgaagaagatccaggagctatcggattcaggccacccagacccc
ttcatggtagccgacctgggtgtgctggccagccatcaccgggccttctgccaggccctg
ccgcgggtctcgcccttctacgcagtaaagtgcaacagcagtgtgtgggtgctgcgtgtt
ctggacaccctgggcaccggcttcgactgcgccagccaggcaaccagtgagtggagggac
cacaggctgctggtcctccggctgttgaccaaggacagcgagagcatctttcccctgagc
accaagttcggggcaagcctggaagcatgtgaacgtctgctcaagtctgccagggacctg
ggcttggctgtggtcggaaccagcttccacgtgggctcgaactgccaaacaccgcacaac
ttcaggcaggccatcgctgactgccggcgtgtatttgagatgggccgagcgttcgggcat
gacatgagcctcctggacatcggagggggcttccccggaggggaaggctgtgagcctcag
tttgaggagatggcgagagtgatcaatgccgccctggcccaggacttccccgaggggagt
ggtgttgagatcatcgcggagcctggacgcttctatgcggcgtctgtctgcatggctgcc
gtcaacatcattgccaagaaggctgtgctggagtctggaggccgccggaaactgctgtac
tatctgaacgatggccactacggcaccttccgcctctgcctcagggagcctgtccccagg
atgcccattgtggtgaaggagctctgctcggacccacccctcttcccctgcaccctgtac
ggtcccacatgtgatgcctttgacaagctcttccgggaggaggtacagctgccggagctg
gatgtgggtgactggcttgtcttcccctccatgggcgcttatacgtcctctatgagctcc
accttcaacggcttcccgcctgcctccacctactacgccatggaacccgagctcagcctc
tgcaatggtcctccccgtccgccggagtcagcccccctcggccaacaccagcgggatctc
ccagcatccctggactaa

DBGET integrated database retrieval system