KEGG   Panthera tigris altaica (Amur tiger): 102950575Help
Entry
102950575         CDS       T02988                                 

Gene name
ACVR2B
Definition
(RefSeq) activin A receptor type 2B
  KO
K13596  activin receptor type-2B [EC:2.7.11.30]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04060  Cytokine-cytokine receptor interaction
ptg04350  TGF-beta signaling pathway
ptg04550  Signaling pathways regulating pluripotency of stem cells
ptg05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    102950575 (ACVR2B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102950575 (ACVR2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102950575 (ACVR2B)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102950575 (ACVR2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptg01001]
    102950575 (ACVR2B)
Enzymes [BR:ptg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     102950575 (ACVR2B)
Protein kinases [BR:ptg01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   102950575 (ACVR2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Activin_recp Pkinase_fungal Toxin_TOLIP
Motif
Other DBs
NCBI-GeneID: 102950575
NCBI-ProteinID: XP_007081106
LinkDB All DBs
Position
Un
AA seq 766 aa AA seqDB search
MKGAASHILEESPAPHPTGVCVVVPREAGSWRQLPPTPAFPAAAPGREHVAGAGDRRGWR
WARVPVEEGVWVRVHTVGIPPGKALSPKAEAVIFLFERCSGAPNSGCARIPALLRGLGPS
VARRCLFLEDLVVPLLDAQVGSGGRNGGEETLLPSSESLCFKLPSDVFVRGTGNQVMIGL
GVLSPHTLAILTLVVGEVELAEGLGAIVCMEMVTPLRTLELGLRAEAMPPVVPALRNPAL
ASLPPGGPGPRTGAGACGPRGRSLTSRLRGTGSGRGEAETRECIYYNANWELERTNQSGL
ERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEG
NFCNERFTHLPEAGGPEVTYEPPPTAPTLLTVLAYSLLPIGGLSLIVLLAFWMYRHRKPP
YGHVDIHEDPGPPPPSPLVGLKPLQLLEIKARGRFGCVWKAQLMNDFVAVKIFPLQDKQS
WQSEREIFSTPGMKHENLLQFIAAEKRGSSLEVELWLITAFHDKGSLTDYLKGNIITWNE
LCHVAETMSRGLSYLHEDVPWCRGEGHKPSIAHRDFKSKNVLLKSDLTAVLADFGLAVRF
EPGKPPGDTHGQVGTRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELVSRCKAADGP
VDEYMLPFEEEIGQHPSLEELQEVVVHKKMRPAIKDHWLKHPGLAQLCVTIEECWDHDAE
ARLSAGCVEERVSLIRRSVNGTTSDCLVSLVTSVTNVDLPPKESSI
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
atgaagggggctgcttcacacatcctggaggagtcccctgcaccccatcccaccggcgtc
tgcgtcgtggttccccgcgaggcgggcagttggcgccagctcccacctacgcccgctttc
cctgcggcggccccaggacgcgagcacgtggcgggggcgggtgaccggcggggctggcgt
tgggctcgcgtgcctgtggaggagggtgtgtgggtgcgggtgcatacagtgggaattccg
ccgggaaaagcgctttcccccaaggccgaagcagtgattttcctcttcgagcggtgctcg
ggcgcgcccaactcgggctgcgcgcggatccccgcgctgctgcggggactcgggcccagc
gtagcccggaggtgcttgtttcttgaggacctggtggtgccactcctggatgcccaagtt
gggagtgggggccgaaatgggggagaggagacgctgctgccttcttctgagtctctgtgt
tttaaattgcccagcgatgtctttgtccgaggtactggaaaccaggtgatgattgggctg
ggggttcttagtccccacaccctggccattcttactctggttgtgggggaggtggagctt
gcagaggggcttggtgcgattgtctgcatggagatggtaactcccctgaggactctagag
cttgggctgcgggctgaggccatgcctcctgttgtccctgcccttcgaaatcctgcccta
gccagcctccctccgggtggcccgggacccaggaccggtgcaggggcgtgtggaccgcgc
ggccgttctctcacctctcgccttcggggcacaggttccgggcgtggggaggccgagacc
cgggagtgcatttactacaacgccaactgggagctggagcgcaccaaccagagcggcctg
gagcgctgcgagggcgagcaggacaagcggctgcactgctacgcctcctggcgcaacagc
tcaggcaccatcgagctcgtcaagaagggctgctggctggacgacttcaactgctatgac
aggcaggagtgtgtggccaccgaggagaacccccaggtgtacttctgctgctgtgaaggc
aacttctgcaacgagcgcttcacccacttgccagaggctgggggcccagaagtcacgtac
gagccacccccgacagcccccaccctgctcacggtgctggcctactcgctgctgcccatt
gggggcctctccctcatcgtcttgctggccttctggatgtaccggcatcgcaagcccccc
tacggccacgtggacatccacgaggaccctgggcctccacctccatcccctctggtgggc
ctgaagccactgcagctgctggagatcaaggcccgggggcgctttggttgtgtctggaag
gcacagctcatgaatgactttgtggctgtcaagatcttcccgctccaggacaagcagtca
tggcagagcgaacgggagatcttcagcacacccggcatgaagcatgagaacctgctgcag
ttcatcgccgctgagaagcgaggctccagccttgaggtggagctgtggctcatcacagct
ttccatgacaagggctccctcacggattacctcaaggggaacatcatcacgtggaacgaa
ctgtgtcacgtggcagagaccatgtcaagaggcctctcataccttcatgaggatgtgccc
tggtgccgtggcgagggccacaagccgtctattgcccacagggactttaaaagcaagaat
gtattgctcaagagcgacctcacagccgtgctggctgactttggtctggctgttcggttt
gagccagggaaaccgccgggggacactcatgggcaggtgggcacgcggcgttacatggcc
cctgaggtgcttgagggagccatcaacttccagagagatgccttcctgcgcatcgacatg
tatgccatggggctggtgctgtgggagcttgtgtcgcgctgcaaggccgcggacggaccc
gtggacgagtacatgctgccctttgaggaagagattggccagcacccatcactggaggag
ctgcaagaggtggtcgtgcacaagaagatgcggcccgccattaaggatcactggctgaag
cacccgggcctggcccagctctgtgtaaccatcgaggagtgctgggaccacgacgcggag
gctcgcctgtctgcgggctgcgtggaggagcgcgtgtccctgatccggaggtcggtcaac
ggcactacctcggactgtcttgtctccctggtgacctccgtcaccaacgtggacctgccc
cctaaggagtcgagcatctaa

DBGET integrated database retrieval system