KEGG   Panthera tigris altaica (Amur tiger): 102950698Help
Entry
102950698         CDS       T02988                                 

Gene name
AICDA
Definition
(RefSeq) activation induced cytidine deaminase
  KO
K10989  activation-induced cytidine deaminase [EC:3.5.4.38]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04672  Intestinal immune network for IgA production
ptg05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    102950698 (AICDA)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    102950698 (AICDA)
Enzymes [BR:ptg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.38  single-stranded DNA cytosine deaminase
     102950698 (AICDA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: APOBEC2 NAD1 APOBEC_N NAD2 SNAD4 APOBEC3 APOBEC_C APOBEC4_like APOBEC4 APOBEC1 RcbX DUF2599
Motif
Other DBs
NCBI-GeneID: 102950698
NCBI-ProteinID: XP_015396313
LinkDB All DBs
Position
Un
AA seq 198 aa AA seqDB search
MDSLLMKQRKFLYHFKNVRWAKGRHETYLCYVVKRRDSATSFSLDFGHLRNKNGCHVELL
FLRYISDWDLDPGRCYRVTWFTSWSPCYDCARHVADFLRGYPNLSLRIFTARLYFCEDRK
AEPEGLRRLHRAGVQIAIMTFKDYFYCWNTFVENREKTFKAWEGLHENSVRLSRQLRRIL
LPLYEVDDLRDAFRTLGL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggacagcctcctgatgaagcagaggaagtttctctaccatttcaagaatgtccgctgg
gcgaagggtcgccatgagacctacttgtgctacgtggtgaagcggcgggacagtgccacc
tccttttcattggacttcggtcaccttcgaaacaagaacggctgccacgtggaactgctc
ttcctccgctacatctccgactgggacctggaccctggccgctgctaccgcgtcacctgg
ttcacctcctggagcccctgctacgactgcgcccggcacgtggccgactttctgagaggg
taccccaacctcagtctgaggatcttcaccgcgcgcctctacttctgcgaggaccgcaag
gccgagcccgaggggctgcggcgcctgcaccgcgcgggcgtccaaatcgccatcatgacc
ttcaaagattatttttattgctggaatacttttgtggaaaatcgtgaaaaaactttcaaa
gcctgggaggggttgcatgaaaattcagttcgtctatccagacagcttcgacgcattctt
ttgcccctgtatgaggttgatgacttgagagatgcatttcgtactttgggactttga

DBGET integrated database retrieval system