KEGG   Panthera tigris altaica (Amur tiger): 102950807
Entry
102950807         CDS       T02988                                 

Gene name
TK2
Definition
(RefSeq) thymidine kinase 2, mitochondrial
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00240  Pyrimidine metabolism
ptg00983  Drug metabolism - other enzymes
ptg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    102950807 (TK2)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    102950807 (TK2)
Enzymes [BR:ptg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     102950807 (TK2)
SSDB
Motif
Pfam: dNK AAA_33 AAA_18 Thymidylate_kin AAA_17 CoaE TsaE
Other DBs
NCBI-GeneID: 102950807
NCBI-ProteinID: XP_007090303
LinkDB
Position
Un
AA seq 265 aa
SLPALWPEPETTPSLRDFLRGRGGARAIVGSYSGPQPAANKDRENEKEKKSVICVEGNIA
SGKTTCLEFFSKTTGIEVLQEPVPKWRNVRGHNPLGLLYRDACRWGFTLQTYVQLTMLDH
HTRPQTSPVRLMERSIHSARYVFVENLYRSGKMPEVDYVILAEWFDWIVRNIDVSIDLIV
YLRTTPETCYQRLQMRCREEETVISLEYLDALHRLYEEWLFKGGLFPVAAPVLVIEADHD
RKKMLELFEQNRDRILTPENQKHGS
NT seq 798 nt   +upstreamnt  +downstreamnt
tcactccccgccctctggcctgaacccgaaactactccaagcctccgggatttcctgcgg
gggcgtggaggggcgagggcaatcgttggcagctactccggaccccagccggccgccaat
aaagatagagaaaatgaaaaagagaaaaaatcagtgatctgtgttgagggcaatattgca
agtgggaagacgacatgcctcgagttcttctccaaaacaacagggattgaggtgttacag
gagccagtgcccaagtggagaaatgtccgtggccataatcctctgggtctgctgtaccgc
gatgcttgtcgatggggcttcacgctgcagacatatgtgcagctcacgatgctggaccac
cacactcgtccccagacatcaccggtacgattgatggagcggtcgattcacagcgcaaga
tatgtttttgtagaaaacctgtatagaagtgggaagatgcctgaagtggactatgtgatt
ctggcagaatggtttgattggattgtgaggaacatcgacgtgtccattgatttgatagtt
tatctccggaccacccctgagacctgttatcagaggttacagatgagatgcagggaggag
gagacagtcatttccctggaatacttggatgctcttcaccgcctctatgaggagtggctc
ttcaaaggaggccttttccctgtggcagcccctgttctggtgattgaggctgaccacgac
aggaagaaaatgttagaactctttgaacaaaaccgggaccgcatactaactccagagaat
cagaaacatggctcatag

KEGG   Panthera tigris altaica (Amur tiger): 107180503
Entry
107180503         CDS       T02988                                 

Gene name
TK1
Definition
(RefSeq) thymidine kinase 1
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00240  Pyrimidine metabolism
ptg00983  Drug metabolism - other enzymes
ptg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    107180503 (TK1)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    107180503 (TK1)
Enzymes [BR:ptg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     107180503 (TK1)
SSDB
Motif
Pfam: TK
Other DBs
NCBI-GeneID: 107180503
NCBI-ProteinID: XP_015397213
LinkDB
Position
Un
AA seq 128 aa
MFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTRYSSSFSTHDRNTMEALPACLLRDVAQE
ALGVAVIGIDEGQFFPDIVEFSETMANAGKTVTVAALDGTFQRKAFGTILNLVPLAESVV
KLTAGGME
NT seq 384 nt   +upstreamnt  +downstreamnt
atgttctcgggaaaaagtactgagctgatgagacgggtccgtcgcttccagatcgcccag
tacaagtgcttggtcatcaagtacgccaaagacactcggtatagcagcagcttctccacg
cacgaccgaaacaccatggaggcactgccagcctgcctgctccgggatgtggcccaggag
gccctaggcgtggctgtcataggcatcgacgaagggcagtttttcccagacatcgtggag
ttcagcgagactatggccaatgccgggaagaccgtcactgtggctgcactggatgggacc
ttccagaggaaggccttcgggaccatcctgaacctggtgcccctggcggagagtgttgtg
aagctgacggcggggggcatggag

DBGET integrated database retrieval system