KEGG   Panthera tigris altaica (Amur tiger): 102950821
Entry
102950821         CDS       T02988                                 

Gene name
FOSL1
Definition
(RefSeq) FOS like 1, AP-1 transcription factor subunit
  KO
K04502  fos-like antigen 1
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04310  Wnt signaling pathway
ptg04380  Osteoclast differentiation
ptg04657  IL-17 signaling pathway
ptg05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102950821 (FOSL1)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    102950821 (FOSL1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102950821 (FOSL1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102950821 (FOSL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptg03000]
    102950821 (FOSL1)
Transcription factors [BR:ptg03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    102950821 (FOSL1)
SSDB
Motif
Pfam: SPAM DUF3450 Prefoldin_2 Tektin MCC-bdg_PDZ MYO10_CC
Other DBs
NCBI-GeneID: 102950821
NCBI-ProteinID: XP_015397426
LinkDB
Position
Un
AA seq 277 aa
MPVTRPAPSHTAREQGFIAKLVSLAAQLCSFWAPRTGSCIEGRWQCGFCPAEAPQSTETS
SLAPPFLAPQKFHLVPSINAVSGSQELQWMVQPHFLGPSSSYPRPLAYPQYSPPQPRPGV
IRALGPPPGVRRRPCEQETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGA
TERDTGDTGGTSGTSSPPPAPSRPVPCISLSSGPVLEPEALHTPTLMTTPSLTPFTPSPV
FTYPSTPEPCASAHRRSSSSSGDPSSDPLGSPTLLAL
NT seq 834 nt   +upstreamnt  +downstreamnt
atgccggttacgagacctgccccaagtcacacagctcgtgagcagggatttatcgccaag
ttagtctctctggctgcccagttgtgctctttctgggctcccagaaccggcagctgcatc
gagggtagatggcagtgtggtttctgtccagcggaagcccctcaatccacagagacctca
tccttggcccctccgtttctcgcccctcagaagtttcacctcgtgccaagcatcaatgcc
gtgagtggcagccaggaactgcagtggatggtacagcctcacttcctgggacccagcagc
agctatcccaggcccctggcctacccccagtacagccccccccagccccggccaggagtc
atcagggccctagggccacctccaggggtccgtcgcaggccctgtgagcaggagactgac
aaactggaggacgagaaatctggtctgcagcgagagattgaggagctgcagaagcagaag
gagcgtctggagctggtgctcgaagcccaccgtcccatctgcaaaatcccggagggggcc
acggagagggacactggcgacacaggcggtaccagcggcaccagcagcccaccaccagcc
ccctcccgccctgtaccatgtatctctctttcctcggggcctgtgcttgaacctgaggca
ttgcacacccccacgctcatgaccacaccctccctgactcctttcacccctagccctgtc
ttcacctaccccagcacccctgagccctgtgcctcagcccatcgcaggagtagcagcagc
agcggggacccatcctccgaccctctgggctctcccaccctccttgccttatga

DBGET integrated database retrieval system