KEGG   Panthera tigris altaica (Amur tiger): 102950877
Entry
102950877         CDS       T02988                                 

Gene name
MSH3
Definition
(RefSeq) mutS homolog 3
  KO
K08736  DNA mismatch repair protein MSH3
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01524  Platinum drug resistance
ptg03430  Mismatch repair
ptg05200  Pathways in cancer
ptg05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    102950877 (MSH3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102950877 (MSH3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102950877 (MSH3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102950877 (MSH3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ptg03400]
    102950877 (MSH3)
DNA repair and recombination proteins [BR:ptg03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     102950877 (MSH3)
SSDB
Motif
Pfam: MutS_V MutS_III MutS_I MutS_II MutS_IV
Other DBs
NCBI-GeneID: 102950877
NCBI-ProteinID: XP_007079857
LinkDB
Position
Un
AA seq 1126 aa
MSGRKPASSRAAAAGPAPARQEVLSRFFQSTGNLKSTTSPTGAVPKAGPDSDSAAPLAST
LPPQLPPHVVVEIGRSKKRPLENDGPVQKKAKKVQEKEGRSDSVTSGNVEPKKCLRMKTV
LKSLEKLKEFCCDSALPQNRVQTEPPQERYAVLPKCTDFDDISRLRAKNAVSSEDSKSQI
SQKDKTLFDLSPSGSSQKGNDNLQTTSDPKPSNKRTKSIYTPLELQYIELKQQQKDAILC
VECGYKYRFFGEDAEVAARELNIYCHLDHNFMTASIPTHRLFVHVRRLVAKGYKVGVVKQ
TETAALKAIGDNKSSLFSRKLTALYTKSTLIGEDVNPLVKLDDAINVDEIVTDNSTNFLL
CICEDQENVKDKKKGNIFIGMVGVQPATGEVVFDSFQDSASRLELETRILCLQPVELLLP
SHLSEQTEMLIHRATAARVRDDRIRVERMDNVYFEYSHAFQAVTEFYAKDVVDIQGSQSF
SGIINLEKTVICSLAAIIRYLKEFNLEKVLSKPKNFKQLSGEMEFMTINGTTLRNLEILQ
NQTDMKTKGSLLWVLDHTKTSFGKRKLKKWVTQPLLKLREINARLDAVSEVLHSESSVFG
QIENHLRKLPDIERGLCSIYHKKCSTQEFFLIVKTLYHLKSEFQALIPAVNSHVRSDLLQ
TFILEIPELLSPVERFLKLLNEQAAKSGDKTELFKDLSDFPLIKKRKDEIQEVTHRIQIH
LQDIRKILKNPSAQYVTVSGQEFMIEIKNSAVSCIPTDWVKVGSTKAVSRFHSPFIVENY
RRLNQLREQLVLDCSAEWLDFLEDFSEHYHSLCKAVHHLATVDCIFSLAKVAKQGNYCRP
TLQEERKIMIKNGRHPVIDVLLGEQDQYVPNSTNLSGDSERVMIITGPNMGGKSSYIKQV
ALITIMAQIGSYVPAEEATIGIVDGIFTRMGAADNIYKGQSTFMEELTDTAEIIRQATSQ
SLVILDELGRGTSTHDGIAIAYATLEHFIKDVKSLTLFVTHYPPVCELEKSYLQQVGNYH
MGFLVNEDESKEDPGEEQVPDFVTFLYQITRGIAARSYGLNVAKLADVPEEILKKAASKS
KELEGLVNMKRKRLKCFAKLWVINDAKGLQKWRDEFDVEEISGFSS
NT seq 3381 nt   +upstreamnt  +downstreamnt
atgtcgggtcggaagcctgcctctagtcgcgccgctgccgccggcccagcccctgcaagg
caagaggttttgagcagattcttccagtctacgggaaacctgaaatccactacgtccccc
acgggtgcagtcccgaaggccggccctgactctgattccgcagcgcccctagcgtccact
ctcccgcctcagttgccgccacacgtggttgtggaaatcggcagaagtaaaaagagacca
ctggagaatgatgggcctgttcaaaagaaggcaaagaaagtccaagaaaaggaaggaagg
agtgattcagtaacgtctgggaatgttgagccaaagaaatgtctgaggatgaagactgtt
ttaaagtctctggaaaaattgaaagaattctgctgcgattctgcccttcctcaaaataga
gtccagacagagcctcctcaggagagatacgcagttctgccaaaatgtactgattttgac
gatatcagtcgtctccgtgcaaagaatgcagtttcttctgaagattccaaatctcaaatt
agtcaaaaggacaagacacttttcgatctcagtccttctggatcttcacaaaagggtaat
gacaatttacagacaacttctgatcctaaaccatctaacaaacggaccaaaagcatctac
acacctttagaattacagtacattgaattgaagcagcagcagaaagatgcaattttgtgt
gtggaatgtggatataagtatagattctttggggaagatgcagaggttgcagcccgggag
ctcaatatttattgccatttagatcacaactttatgacagcaagcatacctactcacaga
ctgtttgttcatgtacgccgcctcgtggccaagggatataaggtgggagtcgtgaagcag
actgaaactgcggcattaaaggccattggggataacaaaagttcacttttttcccggaaa
ttgactgctctttatacaaaatctacacttattggagaagatgtgaatcctttagtcaag
ctggatgatgctataaatgtcgatgagatagtgactgacaattctaccaactttcttctg
tgtatctgtgaagatcaggaaaatgttaaggacaaaaaaaaggggaacattttcattgga
atggtgggagtgcagcctgccacaggtgaggtcgtgtttgatagtttccaggactctgct
tcccgtttggagctcgaaactcggatattgtgcctgcagcccgtggagctactgctcccc
tcacacttgtcagagcaaacagagatgcttatccacagagccacagctgctcgtgtgcgg
gatgacagaattcgagtagaaaggatggataacgtgtattttgaatacagccatgctttc
caggcagttacagagttttatgcaaaagatgtagttgacatccaaggttctcaaagtttt
tctggcatcattaacttggagaagactgtgatttgctctttggctgctataataagatac
ctcaaagaatttaacttggaaaaggtgctttccaaacccaagaattttaagcagttgtct
ggtgaaatggaattcatgacaattaatggaacaacattaaggaatcttgaaatcctacag
aatcagactgacatgaaaaccaaaggaagtttactttgggttttagaccatactaaaacc
tcatttgggaaacggaagttaaagaagtgggtgacccagccactccttaaactaagggag
ataaatgctcgactagatgctgtatcggaagtactccattcagaatccagtgtgtttggt
cagatagaaaatcatctacgtaaattgcctgatatagagagaggactctgtagcatttat
cacaaaaaatgttctacacaagagttcttcttgattgtcaaaaccctgtatcacctgaag
tcagaatttcaagcattaatacctgctgttaattcccacgttcggtcagacttgctccag
acatttattttagaaattcctgaactcctcagtccagtggaacgtttcttaaagctactt
aatgaacaagctgccaaaagtggggataaaacagaattattcaaagatctttctgacttc
cctttaataaaaaagaggaaggatgaaattcaagaagttactcacaggatccaaatacat
ttgcaagatatacgaaaaatactaaaaaatccttctgcacagtatgtgacagtatcagga
caggagtttatgattgaaataaagaattctgctgtatcttgtataccaactgattgggtt
aaggttggaagcacaaaagctgtgagccgctttcactctccttttattgtagaaaattac
agacgtctgaatcagctccgggagcagctagtccttgactgcagtgctgaatggcttgat
tttctagaggattttagtgaacattatcactccttgtgtaaagcagtacatcacctagca
actgttgactgcattttctccctggccaaggtcgctaagcaaggaaattactgcagacca
actctacaagaagaaaggaagatcatgattaaaaatggccggcaccctgtgattgacgtg
ttgctgggagaacaggatcaatatgttcccaacagtacgaatttatcaggggactcagag
agagtaatgataattactggaccaaacatgggtggaaagagctcctacataaaacaagtt
gcattgattactatcatggctcagattggctcctatgttcctgcagaggaagcaacaatt
ggaattgtggatggcattttcacgaggatgggtgctgcagataatatatataaagggcag
agtacctttatggaagaactgactgacacagcagaaataataagacaggccacatcccag
tccttggttatcttggatgaattgggaagaggaacaagcacccatgatggaatcgccatc
gcttatgctacactggagcattttattaaagatgtgaaatccttaaccttgtttgtcacc
cattatccaccagtttgtgaattagaaaaaagttacttacaacaggtgggaaattatcac
atgggattcttggtcaatgaggatgaaagcaaagaggatccaggtgaagaacaagtccct
gattttgtcacatttctttatcaaataaccagaggaattgcagcaaggagttatggacta
aatgtggctaaactagcagatgttcctgaagaaattttaaagaaagcagctagcaagtca
aaagaattagaaggattagtaaatatgaaaaggaaaaggctaaagtgttttgcaaagtta
tgggtgataaatgatgcaaaaggcctgcaaaagtggagagacgagtttgacgtggaagaa
atttcaggcttctcatcttga

KEGG   Panthera tigris altaica (Amur tiger): 102953993
Entry
102953993         CDS       T02988                                 

Gene name
MSH6
Definition
(RefSeq) mutS homolog 6
  KO
K08737  DNA mismatch repair protein MSH6
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01524  Platinum drug resistance
ptg03430  Mismatch repair
ptg05200  Pathways in cancer
ptg05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    102953993 (MSH6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102953993 (MSH6)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102953993 (MSH6)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102953993 (MSH6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ptg03400]
    102953993 (MSH6)
DNA repair and recombination proteins [BR:ptg03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     102953993 (MSH6)
SSDB
Motif
Pfam: MutS_V MutS_III MutS_I MutS_IV PWWP MutS_II
Other DBs
NCBI-GeneID: 102953993
NCBI-ProteinID: XP_015394174
LinkDB
Position
Un
AA seq 1262 aa
MEGYPWWPCLVYNHPFDGTFIREKGKSVRVHVQFFDDSPTRGWVSRRLLKPYTGSKSKEA
QKGGHFYSSKPEILRAMQRADEALNKDKIERLELAVCDEPSEPEEEEEMEVGATYSSDKS
EEDKEIESEEEVPPKVQGSRRSSRQIKKRRVISDSESDVGGSDVEFKPDAKEEGSSDEIS
SGVGDSDSEGLDSPVKVASKRKKMVSGNGALKRKSSRKEMPLATKRSTGISSETKSTLSA
FSAPQNSESQAHTGGGCEDSSRPTFWYHETLEWLKEEKRRDLHRRRPDHPDFDASTLYVP
EDFLNSCTPGMRKWWQIKSQNFDLVIFYKVGKFYELYHMDALIGVNELGLVFMKGNWAHS
GFPEIAFGRYSDSLVQKGYKVARVEQTETPEMMEARCRKMAHISKYDRVVRREICRVITK
GTQTYSVLEGDPSENYSKYLLSLKEKEEDSSGHTRVYGVCFVDTSLGKFFIGQFPDDRHC
SRFRTLVAHYPPVQVLFEKGNLSTETKMILKGSLSSSLQEGLIPGSQFWDAAKTLRTLLE
EAYFKEKLNEDSGVMLPQVLKGMTSESDSLGLTPGEKSELALSALGGCVFYLKKCLIDQE
LLSMANFEEYIPLDSDRVSATRPGAVFAKANQRMVLDAVTLSNLEIFLNGTNGSTEGTLL
EKIDTCHTPFGKRLLKQWLCAPLCSPYAINDRLDAIEDLMAVPDKISDVADLLKKIPDLE
RLLSKIHNVGSPLKSQNHPDSRAIMYEETTYSKKKIIDFLSALEGFKVICKIIEIMEEVA
DNFKSKILKQVITLQTKNPEGRFPDLTIELNRWDTAFDHEKARRTGLITPKAGFDPDYDQ
ALADIRENEQSLLEYLEKQRSRIGCRTIVYWGIGRNRYQLEIPENFITRNLPEEYELKST
KKGCKRYWTKTIEKKLANLINAEERRDVSLKDCMRRLFYNFDKNYKDWQSAVECIAVLDV
LLCLANYSRGGDGPMCRPVILFPEEDTPPFLDLRGSRHPCITKTFFGDDFIPNDILIGCE
EEEEENGKAYCVLVTGPNMGGKSTLMRQAGLLAVMAQTGCYIPAEVCRLTPIDRVFTRLG
ASDRIMSGESTFFVELSETASILTHATAHSLVLVDELGRGTATFDGTAIANAVVKELAEN
IKCRTLFSTHYHSLVEDYSQNVAVRLGHMACMVENECEDPSQETITFLYKFIKGACPKSY
GFNAAKLANLPEEIIQKGHRKAREFEKMTQSLRLFREVCLASERSTIDAEAVPKLLTLIK
EL
NT seq 3789 nt   +upstreamnt  +downstreamnt
atggagggttacccctggtggccttgcctggtttataaccacccttttgatggaacattc
atccgcgagaaagggaagtctgtccgagttcatgtacagttttttgatgacagcccaaca
aggggctgggttagcagaaggctattaaagccatatacaggttcaaaatcgaaagaagca
caaaaaggaggtcatttttatagttcaaagcctgaaatactcagagcaatgcaacgtgca
gatgaagccttgaataaagacaagatcgagaggcttgaattggcagtgtgtgatgagccc
tcagaaccagaggaagaagaagagatggaggtaggtgcaacttactcatcagataagagt
gaagaagataaggaaattgaaagtgaagaagaagtgccacctaaggtgcaaggatctagg
cgaagtagccgccagataaaaaaacgaagggtcatatcagattctgagagtgatgttggt
ggctctgatgtggaattcaagccagatgctaaggaggaaggaagcagtgatgaaataagc
agtggagtgggggacagtgacagtgaaggcttggacagccctgtcaaagttgcttcaaaa
cggaagaaaatggtgtctggaaatggcgctctcaaaaggaaaagttcaaggaaggaaatg
cccttggccaccaaacgatcaactggcatttcatcagaaaccaagagcactctgagtgct
ttctctgcccctcagaattctgaatctcaagcccacactggtggaggatgtgaggatagt
agtcgccccactttctggtatcatgaaactttagagtggcttaaggaggaaaagagacga
gatctccacaggaggcgacctgatcaccccgattttgatgcatccacactctatgtgcct
gaggatttccttaattcctgtactcctgggatgaggaagtggtggcagattaagtctcag
aactttgatcttgttattttttataaggtggggaagttttatgagttgtaccacatggat
gctcttattggagtcaatgaactcgggctggtattcatgaaaggcaactgggctcattct
ggtttccctgaaattgcatttggccgatactctgattctctggttcagaagggctataaa
gtagcacgagtggaacagactgagaccccggaaatgatggaggcacgatgccggaagatg
gcacatatatctaagtatgacagagtggtgaggagggagatctgtagagtcattaccaag
ggtacacagacctacagtgtactggaaggtgacccctctgagaactacagtaagtatctt
cttagcctcaaagaaaaagaggaggattcctctggccacactcgagtgtatggagtatgc
tttgttgatacctcactgggaaagtttttcataggtcagtttccagacgatcgccactgt
tctagatttaggactctagtggcacactaccctccagtacaagtcttgtttgagaaagga
aatctctcaacagaaactaagatgattctgaagggttcattatcctcctctcttcaggaa
ggtctgataccaggctcccagttttgggatgcagccaaaactttgagaactctccttgaa
gaagcatattttaaggaaaagttaaatgaggacagtggggtgatgttaccccaggtgctt
aaaggtatgacctcagagtctgattctcttgggttaacaccaggagagaagagtgaattg
gccctctctgctctaggtggttgtgtcttctacctcaaaaaatgccttattgatcaagag
cttttatcaatggctaattttgaagaatacattcccttggattctgacagggttagtgct
acaagacctggtgctgtttttgcaaaagccaatcaacggatggtgctagatgctgtgaca
ttaagcaacttggagattttcctgaatggaacaaatggttctactgaagggaccctgcta
gaaaagattgatacttgccatactccctttggtaagcggctcctaaagcagtggctttgt
gccccactctgtagcccttatgctatcaatgatcgtttagatgctatagaagacctcatg
gctgtgcctgacaaaatctctgatgttgcagaccttctaaagaagattccagaccttgag
aggctgctgagtaaaattcataatgttgggtctcccctgaagagccagaaccacccagat
agcagggctataatgtatgaagaaactacatacagcaaaaaaaagattattgattttctt
tctgctctagaaggattcaaagtaatatgtaaaattatagagattatggaagaagttgct
gacaactttaagtctaaaatccttaagcaagtcattactttgcagacaaaaaatcctgag
ggccgttttcctgatttgactatagaactgaaccgatgggatacagcctttgaccatgaa
aaggctcgaaggactggactaattactcccaaagcaggatttgaccctgattatgaccaa
gctcttgctgacataagagaaaatgaacagagcctcctggaatacttggagaaacagcgc
agtcgaattggctgtaggaccattgtctactgggggattggcaggaaccgttaccagttg
gaaattccagagaatttcatcactcgtaatttgccagaagaatatgagttgaaatccacc
aagaagggctgtaaacgatactggaccaaaactattgagaagaagttggctaatctgata
aacgctgaagagcggagagacgtatcattgaaagactgcatgcggcgactcttctataac
tttgataaaaattacaaagactggcagtctgctgttgagtgcatcgcagtattggatgtc
ttactgtgcctggctaactacagtcgagggggtgatggccctatgtgtcgtccagtaatt
ctgtttccagaagaagacacaccccccttcttggaccttagaggatcacgtcatccctgc
attacgaagactttttttggagatgactttattcctaatgacattctaataggctgtgag
gaagaggaggaggaaaatggcaaagcttattgtgtgcttgttactggacctaatatgggg
ggcaagtcgacactcatgagacaggctggcctgttagctgtaatggcccagacgggttgt
tacatacctgctgaagtatgcaggctcacacctattgatagagtatttactagacttggt
gcctcagacagaataatgtcaggtgaaagtacattttttgttgaactgagtgaaactgcc
agtatccttacacacgcaacagcacattctctggtgcttgtggatgaattaggaagaggt
actgcaacatttgatggaacagcaatagcaaatgcagttgttaaagaacttgctgagaac
ataaagtgtcgtacattgttttctacccattaccattcattagtggaagattattctcaa
aacgttgcagtgcgcctgggacacatggcatgcatggtagaaaatgaatgtgaggatccc
agccaggagactattaccttcctgtataaattcattaagggagcttgtcctaaaagctat
ggctttaatgcagcaaagcttgctaatcttccagaggagattattcaaaagggacataga
aaagcaagagaatttgagaagatgacccaatcactgcgattatttcgggaagtttgcctg
gctagtgaaaggtcgactatagatgctgaagctgtccctaagttgctgactttgattaag
gaattatag

DBGET integrated database retrieval system