KEGG   Panthera tigris altaica (Amur tiger): 102950880
Entry
102950880         CDS       T02988                                 

Gene name
MAPK8
Definition
(RefSeq) mitogen-activated protein kinase 8
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01522  Endocrine resistance
ptg04010  MAPK signaling pathway
ptg04012  ErbB signaling pathway
ptg04014  Ras signaling pathway
ptg04024  cAMP signaling pathway
ptg04068  FoxO signaling pathway
ptg04071  Sphingolipid signaling pathway
ptg04137  Mitophagy - animal
ptg04140  Autophagy - animal
ptg04141  Protein processing in endoplasmic reticulum
ptg04210  Apoptosis
ptg04215  Apoptosis - multiple species
ptg04217  Necroptosis
ptg04310  Wnt signaling pathway
ptg04380  Osteoclast differentiation
ptg04510  Focal adhesion
ptg04530  Tight junction
ptg04620  Toll-like receptor signaling pathway
ptg04621  NOD-like receptor signaling pathway
ptg04622  RIG-I-like receptor signaling pathway
ptg04625  C-type lectin receptor signaling pathway
ptg04657  IL-17 signaling pathway
ptg04658  Th1 and Th2 cell differentiation
ptg04659  Th17 cell differentiation
ptg04660  T cell receptor signaling pathway
ptg04664  Fc epsilon RI signaling pathway
ptg04668  TNF signaling pathway
ptg04722  Neurotrophin signaling pathway
ptg04723  Retrograde endocannabinoid signaling
ptg04728  Dopaminergic synapse
ptg04750  Inflammatory mediator regulation of TRP channels
ptg04910  Insulin signaling pathway
ptg04912  GnRH signaling pathway
ptg04914  Progesterone-mediated oocyte maturation
ptg04917  Prolactin signaling pathway
ptg04920  Adipocytokine signaling pathway
ptg04926  Relaxin signaling pathway
ptg04930  Type II diabetes mellitus
ptg04931  Insulin resistance
ptg04932  Non-alcoholic fatty liver disease
ptg04933  AGE-RAGE signaling pathway in diabetic complications
ptg04935  Growth hormone synthesis, secretion and action
ptg05010  Alzheimer disease
ptg05012  Parkinson disease
ptg05016  Huntington disease
ptg05017  Spinocerebellar ataxia
ptg05020  Prion disease
ptg05022  Pathways of neurodegeneration - multiple diseases
ptg05132  Salmonella infection
ptg05133  Pertussis
ptg05135  Yersinia infection
ptg05142  Chagas disease
ptg05145  Toxoplasmosis
ptg05152  Tuberculosis
ptg05161  Hepatitis B
ptg05162  Measles
ptg05166  Human T-cell leukemia virus 1 infection
ptg05167  Kaposi sarcoma-associated herpesvirus infection
ptg05169  Epstein-Barr virus infection
ptg05170  Human immunodeficiency virus 1 infection
ptg05171  Coronavirus disease - COVID-19
ptg05200  Pathways in cancer
ptg05210  Colorectal cancer
ptg05212  Pancreatic cancer
ptg05231  Choline metabolism in cancer
ptg05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102950880 (MAPK8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102950880 (MAPK8)
   04012 ErbB signaling pathway
    102950880 (MAPK8)
   04014 Ras signaling pathway
    102950880 (MAPK8)
   04310 Wnt signaling pathway
    102950880 (MAPK8)
   04668 TNF signaling pathway
    102950880 (MAPK8)
   04068 FoxO signaling pathway
    102950880 (MAPK8)
   04071 Sphingolipid signaling pathway
    102950880 (MAPK8)
   04024 cAMP signaling pathway
    102950880 (MAPK8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102950880 (MAPK8)
   04137 Mitophagy - animal
    102950880 (MAPK8)
  09143 Cell growth and death
   04210 Apoptosis
    102950880 (MAPK8)
   04215 Apoptosis - multiple species
    102950880 (MAPK8)
   04217 Necroptosis
    102950880 (MAPK8)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102950880 (MAPK8)
   04530 Tight junction
    102950880 (MAPK8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102950880 (MAPK8)
   04621 NOD-like receptor signaling pathway
    102950880 (MAPK8)
   04622 RIG-I-like receptor signaling pathway
    102950880 (MAPK8)
   04625 C-type lectin receptor signaling pathway
    102950880 (MAPK8)
   04660 T cell receptor signaling pathway
    102950880 (MAPK8)
   04658 Th1 and Th2 cell differentiation
    102950880 (MAPK8)
   04659 Th17 cell differentiation
    102950880 (MAPK8)
   04657 IL-17 signaling pathway
    102950880 (MAPK8)
   04664 Fc epsilon RI signaling pathway
    102950880 (MAPK8)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102950880 (MAPK8)
   04920 Adipocytokine signaling pathway
    102950880 (MAPK8)
   04912 GnRH signaling pathway
    102950880 (MAPK8)
   04914 Progesterone-mediated oocyte maturation
    102950880 (MAPK8)
   04917 Prolactin signaling pathway
    102950880 (MAPK8)
   04926 Relaxin signaling pathway
    102950880 (MAPK8)
   04935 Growth hormone synthesis, secretion and action
    102950880 (MAPK8)
  09156 Nervous system
   04728 Dopaminergic synapse
    102950880 (MAPK8)
   04723 Retrograde endocannabinoid signaling
    102950880 (MAPK8)
   04722 Neurotrophin signaling pathway
    102950880 (MAPK8)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102950880 (MAPK8)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102950880 (MAPK8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102950880 (MAPK8)
   05231 Choline metabolism in cancer
    102950880 (MAPK8)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102950880 (MAPK8)
   05212 Pancreatic cancer
    102950880 (MAPK8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102950880 (MAPK8)
   05012 Parkinson disease
    102950880 (MAPK8)
   05016 Huntington disease
    102950880 (MAPK8)
   05017 Spinocerebellar ataxia
    102950880 (MAPK8)
   05020 Prion disease
    102950880 (MAPK8)
   05022 Pathways of neurodegeneration - multiple diseases
    102950880 (MAPK8)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102950880 (MAPK8)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102950880 (MAPK8)
   04932 Non-alcoholic fatty liver disease
    102950880 (MAPK8)
   04931 Insulin resistance
    102950880 (MAPK8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102950880 (MAPK8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102950880 (MAPK8)
   05135 Yersinia infection
    102950880 (MAPK8)
   05133 Pertussis
    102950880 (MAPK8)
   05152 Tuberculosis
    102950880 (MAPK8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102950880 (MAPK8)
   05170 Human immunodeficiency virus 1 infection
    102950880 (MAPK8)
   05161 Hepatitis B
    102950880 (MAPK8)
   05171 Coronavirus disease - COVID-19
    102950880 (MAPK8)
   05162 Measles
    102950880 (MAPK8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102950880 (MAPK8)
   05169 Epstein-Barr virus infection
    102950880 (MAPK8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102950880 (MAPK8)
   05142 Chagas disease
    102950880 (MAPK8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102950880 (MAPK8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptg01001]
    102950880 (MAPK8)
Enzymes [BR:ptg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102950880 (MAPK8)
Protein kinases [BR:ptg01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102950880 (MAPK8)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2 DUF530
Other DBs
NCBI-GeneID: 102950880
NCBI-ProteinID: XP_007080075
LinkDB
Position
Un
AA seq 427 aa
MSRSKRDSNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEASA
GPLGCCR
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgagcagaagcaagcgtgacagcaatttttatagtgtagagattggagattctacattt
acagttttgaaacgatatcagaatttaaaacctataggctcaggagctcaaggaattgta
tgtgcagcttatgatgccattcttgaaagaaatgttgcaatcaagaagctgagccggccg
tttcagaatcagacccatgctaaacgggcttacagagagctagttctaatgaaatgtgtt
aatcacaaaaatataattggccttttgaatgttttcacaccacagaaatccctagaagaa
tttcaagatgtttacatagtcatggagctcatggatgcaaatctttgccaagtgattcag
atggaactagatcatgaaagaatgtcctaccttctctatcagatgctgtgtggaatcaag
caccttcactctgctggaattattcatcgggacttaaagcccagtaatatagtggtaaaa
tcagactgcactttgaagattcttgactttggactggccaggactgcaggaactagtttt
atgatgacgccttacgtagtgactcgctactacagagcacctgaggtcatcctagggatg
ggctacaaagaaaacgttgacatttggtcagttgggtgcatcatgggagaaatgatcaaa
ggtggtgttttgttcccaggtacagatcatattgatcagtggaataaagttattgaacag
cttggaacaccatgccctgaattcatgaagaaactacaaccaacagtaaggacttacgtt
gaaaacagacctaaatatgctggatatagctttgagaaactcttccccgatgtacttttc
ccagctgactcggaacacaacaaacttaaagccagtcaggcaagggacttgttatccaaa
atgctggtaattgatgcatctaaaaggatctctgtagacgaagccctccagcatccatat
atcaatgtctggtatgatccttctgaagcagaagctccaccacccaagatacctgacaag
caattagatgaaagggaacatacaatagaagagtggaaagagttgatatacaaagaagtt
atggacttggaggagagaaccaagaatggagttatacgggggcagccctctcctttaggt
gcagcagtgatcaatggctctcagcatccatcgtcatcatcgtctgtcaatgatgtgtct
tcaatgtcaacagatccgactttggcctcagatacagatagcagtctggaagcatcagct
ggacctctgggctgttgtagatga

KEGG   Panthera tigris altaica (Amur tiger): 102959159
Entry
102959159         CDS       T02988                                 

Gene name
MAPK10
Definition
(RefSeq) mitogen-activated protein kinase 10
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01522  Endocrine resistance
ptg04010  MAPK signaling pathway
ptg04012  ErbB signaling pathway
ptg04014  Ras signaling pathway
ptg04024  cAMP signaling pathway
ptg04068  FoxO signaling pathway
ptg04071  Sphingolipid signaling pathway
ptg04137  Mitophagy - animal
ptg04140  Autophagy - animal
ptg04141  Protein processing in endoplasmic reticulum
ptg04210  Apoptosis
ptg04215  Apoptosis - multiple species
ptg04217  Necroptosis
ptg04310  Wnt signaling pathway
ptg04380  Osteoclast differentiation
ptg04510  Focal adhesion
ptg04530  Tight junction
ptg04620  Toll-like receptor signaling pathway
ptg04621  NOD-like receptor signaling pathway
ptg04622  RIG-I-like receptor signaling pathway
ptg04625  C-type lectin receptor signaling pathway
ptg04657  IL-17 signaling pathway
ptg04658  Th1 and Th2 cell differentiation
ptg04659  Th17 cell differentiation
ptg04660  T cell receptor signaling pathway
ptg04664  Fc epsilon RI signaling pathway
ptg04668  TNF signaling pathway
ptg04722  Neurotrophin signaling pathway
ptg04723  Retrograde endocannabinoid signaling
ptg04728  Dopaminergic synapse
ptg04750  Inflammatory mediator regulation of TRP channels
ptg04910  Insulin signaling pathway
ptg04912  GnRH signaling pathway
ptg04914  Progesterone-mediated oocyte maturation
ptg04917  Prolactin signaling pathway
ptg04920  Adipocytokine signaling pathway
ptg04926  Relaxin signaling pathway
ptg04930  Type II diabetes mellitus
ptg04931  Insulin resistance
ptg04932  Non-alcoholic fatty liver disease
ptg04933  AGE-RAGE signaling pathway in diabetic complications
ptg04935  Growth hormone synthesis, secretion and action
ptg05010  Alzheimer disease
ptg05012  Parkinson disease
ptg05016  Huntington disease
ptg05017  Spinocerebellar ataxia
ptg05020  Prion disease
ptg05022  Pathways of neurodegeneration - multiple diseases
ptg05132  Salmonella infection
ptg05133  Pertussis
ptg05135  Yersinia infection
ptg05142  Chagas disease
ptg05145  Toxoplasmosis
ptg05152  Tuberculosis
ptg05161  Hepatitis B
ptg05162  Measles
ptg05166  Human T-cell leukemia virus 1 infection
ptg05167  Kaposi sarcoma-associated herpesvirus infection
ptg05169  Epstein-Barr virus infection
ptg05170  Human immunodeficiency virus 1 infection
ptg05171  Coronavirus disease - COVID-19
ptg05200  Pathways in cancer
ptg05210  Colorectal cancer
ptg05212  Pancreatic cancer
ptg05231  Choline metabolism in cancer
ptg05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102959159 (MAPK10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102959159 (MAPK10)
   04012 ErbB signaling pathway
    102959159 (MAPK10)
   04014 Ras signaling pathway
    102959159 (MAPK10)
   04310 Wnt signaling pathway
    102959159 (MAPK10)
   04668 TNF signaling pathway
    102959159 (MAPK10)
   04068 FoxO signaling pathway
    102959159 (MAPK10)
   04071 Sphingolipid signaling pathway
    102959159 (MAPK10)
   04024 cAMP signaling pathway
    102959159 (MAPK10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102959159 (MAPK10)
   04137 Mitophagy - animal
    102959159 (MAPK10)
  09143 Cell growth and death
   04210 Apoptosis
    102959159 (MAPK10)
   04215 Apoptosis - multiple species
    102959159 (MAPK10)
   04217 Necroptosis
    102959159 (MAPK10)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102959159 (MAPK10)
   04530 Tight junction
    102959159 (MAPK10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102959159 (MAPK10)
   04621 NOD-like receptor signaling pathway
    102959159 (MAPK10)
   04622 RIG-I-like receptor signaling pathway
    102959159 (MAPK10)
   04625 C-type lectin receptor signaling pathway
    102959159 (MAPK10)
   04660 T cell receptor signaling pathway
    102959159 (MAPK10)
   04658 Th1 and Th2 cell differentiation
    102959159 (MAPK10)
   04659 Th17 cell differentiation
    102959159 (MAPK10)
   04657 IL-17 signaling pathway
    102959159 (MAPK10)
   04664 Fc epsilon RI signaling pathway
    102959159 (MAPK10)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102959159 (MAPK10)
   04920 Adipocytokine signaling pathway
    102959159 (MAPK10)
   04912 GnRH signaling pathway
    102959159 (MAPK10)
   04914 Progesterone-mediated oocyte maturation
    102959159 (MAPK10)
   04917 Prolactin signaling pathway
    102959159 (MAPK10)
   04926 Relaxin signaling pathway
    102959159 (MAPK10)
   04935 Growth hormone synthesis, secretion and action
    102959159 (MAPK10)
  09156 Nervous system
   04728 Dopaminergic synapse
    102959159 (MAPK10)
   04723 Retrograde endocannabinoid signaling
    102959159 (MAPK10)
   04722 Neurotrophin signaling pathway
    102959159 (MAPK10)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102959159 (MAPK10)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102959159 (MAPK10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102959159 (MAPK10)
   05231 Choline metabolism in cancer
    102959159 (MAPK10)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102959159 (MAPK10)
   05212 Pancreatic cancer
    102959159 (MAPK10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102959159 (MAPK10)
   05012 Parkinson disease
    102959159 (MAPK10)
   05016 Huntington disease
    102959159 (MAPK10)
   05017 Spinocerebellar ataxia
    102959159 (MAPK10)
   05020 Prion disease
    102959159 (MAPK10)
   05022 Pathways of neurodegeneration - multiple diseases
    102959159 (MAPK10)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102959159 (MAPK10)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102959159 (MAPK10)
   04932 Non-alcoholic fatty liver disease
    102959159 (MAPK10)
   04931 Insulin resistance
    102959159 (MAPK10)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102959159 (MAPK10)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102959159 (MAPK10)
   05135 Yersinia infection
    102959159 (MAPK10)
   05133 Pertussis
    102959159 (MAPK10)
   05152 Tuberculosis
    102959159 (MAPK10)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102959159 (MAPK10)
   05170 Human immunodeficiency virus 1 infection
    102959159 (MAPK10)
   05161 Hepatitis B
    102959159 (MAPK10)
   05171 Coronavirus disease - COVID-19
    102959159 (MAPK10)
   05162 Measles
    102959159 (MAPK10)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102959159 (MAPK10)
   05169 Epstein-Barr virus infection
    102959159 (MAPK10)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102959159 (MAPK10)
   05142 Chagas disease
    102959159 (MAPK10)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102959159 (MAPK10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptg01001]
    102959159 (MAPK10)
Enzymes [BR:ptg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102959159 (MAPK10)
Protein kinases [BR:ptg01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102959159 (MAPK10)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 102959159
NCBI-ProteinID: XP_007074784
LinkDB
Position
Un
AA seq 464 aa
MSLHLLYYCSEPTLDVKIAFCQGFDKQVDVSYIAKHYNMSKSKVDNQFYSVEVGDSTFTV
LKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNH
KNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHL
HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGY
KENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVEN
RPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYIN
VWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAA
VNSSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAGPLGCCR
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgagcctccatttattgtactactgcagtgaaccaaccttggatgtgaaaattgccttt
tgtcagggatttgataaacaagtggatgtgtcatatattgccaaacattacaacatgagc
aaaagcaaagttgacaaccaattctacagtgtggaagtgggagactcaaccttcacagtt
ctcaagcgctaccagaatttaaagcctattggctctggggctcagggaatagtttgtgct
gcgtatgatgccgttcttgacagaaatgtggccattaagaagctcagcagaccctttcag
aaccaaacgcatgccaagagagcttaccgggagctagtcctcatgaagtgtgtgaaccat
aaaaacattattagtttattaaatgtcttcacaccccagaaaacactggaggagttccag
gatgtttacttagtaatggaactgatggatgccaacttgtgtcaggtgattcagatggaa
ttagaccatgagcgaatgtcttacctgctataccaaatgttgtgtggcatcaagcacctc
cactctgctggaattattcacagggatttaaaaccaagtaacattgtagtcaagtctgat
tgtacattgaaaatcctcgactttggactcgccaggacggcaggcacaagtttcatgatg
actccttatgtggttacccgttattatagagcccctgaggttattctgggaatgggctac
aaggagaacgtggatatatggtctgtgggatgcattatgggagaaatggttcgccacaaa
atcctctttccaggaagggactatattgaccagtggaacaaggtgattgagcaattagga
acgccatgcccagaattcatgaagaaattgcaacccacagtaagaaactatgtggagaat
cggcccaagtatgcaggactcaccttccccaagctctttccagattccctcttcccagcg
gactccgagcacaataaactcaaagccagccaagccagggacttattgtcaaagatgcta
gtgattgatccagcaaaaaggatatccgtggatgacgccttacaacacccttacatcaat
gtctggtatgaccctgccgaagtggaggcgcctccacctcagatatatgacaaacagttg
gacgaaagagaacacaccattgaagaatggaaagaacttatctacaaggaggtaatgaat
tcggaagaaaagactaaaaatggtgttgtaaaaggacaaccttctccttcaggtgcagca
gtgaacagcagtgagagtctccctccatcttcgtctgtcaatgacatctcctccatgtcc
accgaccagaccctggcatctgacactgacagcagcctggaagcctcagcaggacccctg
ggttgttgcaggtga

KEGG   Panthera tigris altaica (Amur tiger): 102963096
Entry
102963096         CDS       T02988                                 

Gene name
MAPK9
Definition
(RefSeq) mitogen-activated protein kinase 9
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01522  Endocrine resistance
ptg04010  MAPK signaling pathway
ptg04012  ErbB signaling pathway
ptg04014  Ras signaling pathway
ptg04024  cAMP signaling pathway
ptg04068  FoxO signaling pathway
ptg04071  Sphingolipid signaling pathway
ptg04137  Mitophagy - animal
ptg04140  Autophagy - animal
ptg04141  Protein processing in endoplasmic reticulum
ptg04210  Apoptosis
ptg04215  Apoptosis - multiple species
ptg04217  Necroptosis
ptg04310  Wnt signaling pathway
ptg04380  Osteoclast differentiation
ptg04510  Focal adhesion
ptg04530  Tight junction
ptg04620  Toll-like receptor signaling pathway
ptg04621  NOD-like receptor signaling pathway
ptg04622  RIG-I-like receptor signaling pathway
ptg04625  C-type lectin receptor signaling pathway
ptg04657  IL-17 signaling pathway
ptg04658  Th1 and Th2 cell differentiation
ptg04659  Th17 cell differentiation
ptg04660  T cell receptor signaling pathway
ptg04664  Fc epsilon RI signaling pathway
ptg04668  TNF signaling pathway
ptg04722  Neurotrophin signaling pathway
ptg04723  Retrograde endocannabinoid signaling
ptg04728  Dopaminergic synapse
ptg04750  Inflammatory mediator regulation of TRP channels
ptg04910  Insulin signaling pathway
ptg04912  GnRH signaling pathway
ptg04914  Progesterone-mediated oocyte maturation
ptg04917  Prolactin signaling pathway
ptg04920  Adipocytokine signaling pathway
ptg04926  Relaxin signaling pathway
ptg04930  Type II diabetes mellitus
ptg04931  Insulin resistance
ptg04932  Non-alcoholic fatty liver disease
ptg04933  AGE-RAGE signaling pathway in diabetic complications
ptg04935  Growth hormone synthesis, secretion and action
ptg05010  Alzheimer disease
ptg05012  Parkinson disease
ptg05016  Huntington disease
ptg05017  Spinocerebellar ataxia
ptg05020  Prion disease
ptg05022  Pathways of neurodegeneration - multiple diseases
ptg05132  Salmonella infection
ptg05133  Pertussis
ptg05135  Yersinia infection
ptg05142  Chagas disease
ptg05145  Toxoplasmosis
ptg05152  Tuberculosis
ptg05161  Hepatitis B
ptg05162  Measles
ptg05166  Human T-cell leukemia virus 1 infection
ptg05167  Kaposi sarcoma-associated herpesvirus infection
ptg05169  Epstein-Barr virus infection
ptg05170  Human immunodeficiency virus 1 infection
ptg05171  Coronavirus disease - COVID-19
ptg05200  Pathways in cancer
ptg05210  Colorectal cancer
ptg05212  Pancreatic cancer
ptg05231  Choline metabolism in cancer
ptg05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102963096 (MAPK9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102963096 (MAPK9)
   04012 ErbB signaling pathway
    102963096 (MAPK9)
   04014 Ras signaling pathway
    102963096 (MAPK9)
   04310 Wnt signaling pathway
    102963096 (MAPK9)
   04668 TNF signaling pathway
    102963096 (MAPK9)
   04068 FoxO signaling pathway
    102963096 (MAPK9)
   04071 Sphingolipid signaling pathway
    102963096 (MAPK9)
   04024 cAMP signaling pathway
    102963096 (MAPK9)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102963096 (MAPK9)
   04137 Mitophagy - animal
    102963096 (MAPK9)
  09143 Cell growth and death
   04210 Apoptosis
    102963096 (MAPK9)
   04215 Apoptosis - multiple species
    102963096 (MAPK9)
   04217 Necroptosis
    102963096 (MAPK9)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102963096 (MAPK9)
   04530 Tight junction
    102963096 (MAPK9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102963096 (MAPK9)
   04621 NOD-like receptor signaling pathway
    102963096 (MAPK9)
   04622 RIG-I-like receptor signaling pathway
    102963096 (MAPK9)
   04625 C-type lectin receptor signaling pathway
    102963096 (MAPK9)
   04660 T cell receptor signaling pathway
    102963096 (MAPK9)
   04658 Th1 and Th2 cell differentiation
    102963096 (MAPK9)
   04659 Th17 cell differentiation
    102963096 (MAPK9)
   04657 IL-17 signaling pathway
    102963096 (MAPK9)
   04664 Fc epsilon RI signaling pathway
    102963096 (MAPK9)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102963096 (MAPK9)
   04920 Adipocytokine signaling pathway
    102963096 (MAPK9)
   04912 GnRH signaling pathway
    102963096 (MAPK9)
   04914 Progesterone-mediated oocyte maturation
    102963096 (MAPK9)
   04917 Prolactin signaling pathway
    102963096 (MAPK9)
   04926 Relaxin signaling pathway
    102963096 (MAPK9)
   04935 Growth hormone synthesis, secretion and action
    102963096 (MAPK9)
  09156 Nervous system
   04728 Dopaminergic synapse
    102963096 (MAPK9)
   04723 Retrograde endocannabinoid signaling
    102963096 (MAPK9)
   04722 Neurotrophin signaling pathway
    102963096 (MAPK9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102963096 (MAPK9)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102963096 (MAPK9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102963096 (MAPK9)
   05231 Choline metabolism in cancer
    102963096 (MAPK9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102963096 (MAPK9)
   05212 Pancreatic cancer
    102963096 (MAPK9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102963096 (MAPK9)
   05012 Parkinson disease
    102963096 (MAPK9)
   05016 Huntington disease
    102963096 (MAPK9)
   05017 Spinocerebellar ataxia
    102963096 (MAPK9)
   05020 Prion disease
    102963096 (MAPK9)
   05022 Pathways of neurodegeneration - multiple diseases
    102963096 (MAPK9)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102963096 (MAPK9)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102963096 (MAPK9)
   04932 Non-alcoholic fatty liver disease
    102963096 (MAPK9)
   04931 Insulin resistance
    102963096 (MAPK9)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102963096 (MAPK9)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102963096 (MAPK9)
   05135 Yersinia infection
    102963096 (MAPK9)
   05133 Pertussis
    102963096 (MAPK9)
   05152 Tuberculosis
    102963096 (MAPK9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102963096 (MAPK9)
   05170 Human immunodeficiency virus 1 infection
    102963096 (MAPK9)
   05161 Hepatitis B
    102963096 (MAPK9)
   05171 Coronavirus disease - COVID-19
    102963096 (MAPK9)
   05162 Measles
    102963096 (MAPK9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102963096 (MAPK9)
   05169 Epstein-Barr virus infection
    102963096 (MAPK9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102963096 (MAPK9)
   05142 Chagas disease
    102963096 (MAPK9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102963096 (MAPK9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptg01001]
    102963096 (MAPK9)
Enzymes [BR:ptg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102963096 (MAPK9)
Protein kinases [BR:ptg01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102963096 (MAPK9)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 102963096
NCBI-ProteinID: XP_007083133
LinkDB
Position
Un
AA seq 424 aa
MSDSKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQ
LGTPSADFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTNQARDLLSN
MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
LDWEERSKNGVVKDQPSDAPVSSNATPSESSSINDISSMSTEQTLASDTDSSLDASTGPL
EGCR
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgagtgacagtaaatgtgatagtcagttttacagtgtgcaagtggcagactcaactttc
actgtcctgaaacgttaccagcagttgaaaccaattggctctggagcccaagggattgtt
tgtgctgcttttgatacagttcttgggataaatgttgcagtcaagaaactaagccgtcct
tttcagaatcaaacccatgcaaagagagcttatcgtgaactcgtcctcttaaaatgtgtc
aatcataaaaatataattagtttgttaaatgtgtttacaccacagaagactctagaagaa
tttcaagatgtgtatttggtcatggaattaatggatgctaacttatgtcaggttattcat
atggagttggaccatgaaagaatgtcctaccttctctaccagatgctctgtggtattaaa
catctgcattcagctggtataattcatagagatttgaaacctagcaacattgtagtaaaa
tcagactgcacgcttaagatccttgactttggcctggcccggacagcatgcaccaacttc
atgatgaccccgtacgtggtgacgcggtattaccgggcacccgaagtcatcctgggcatg
ggctacaaagagaatgttgatatctggtcagtggggtgcatcatgggagagctggtgaaa
ggttgtgtgatattccaaggcactgatcatattgatcagtggaataaagtcattgagcag
ctaggaacgccgtctgcggattttatgaagaaacttcagccgaccgtgagaaattatgta
gaaaacagaccaaagtaccctggaatcaaatttgaagaactcttcccagattggatattc
ccatcagaatctgaacgagacaaaataaaaacaaatcaagccagagatctgttatcgaac
atgttagtgatagaccctgacaagcgcatctctgtagacgaggctctgcgtcacccttac
attactgtttggtatgaccctgctgaagcagaagcgccaccacctcagatttatgatgcc
cagttggaagaaagagagcatgcaattgaggagtggaaagagctgatttacaaagaagta
ctggactgggaagaaagaagcaagaatggtgttgtgaaagatcagccttcagatgcacca
gtaagtagcaacgccactccttccgagtcgtcctccatcaacgacatctcatccatgtca
accgagcagacgttggcctcagacacagacagcagcctcgatgcctcgacgggacccctg
gaaggttgtcgatga

DBGET integrated database retrieval system